Anti-CHRNA5

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58428.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: After binding acetylcholine, the AChR responds by an extensive change in... more

Close menu

Product information "Anti-CHRNA5"

Protein function: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [The UniProt Consortium]

Keywords:	Anti-CHRNA5, Anti-NACHRA5, Anti-Neuronal acetylcholine receptor subunit alpha-5
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58428

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to a sequence at the N-terminus of Human CHRNA5 (44-76aa AKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKF), different from the related Mouse sequence by five amino acids, and from the related Rat sequence by four amino acids
MW:	53 kD
Format:	Antigen Affinity Purified