Anti-CEACAM 21 (CEACAM21, Carcinoembryonic Antigen-related Cell Adhesion Molecule 21, UNQ3098/PRO100

Applications: , Suitable for use in Western Blot. Other applications not tested. Recommended Dilutions: Western Blot (Tissue lysate): 1:500-1:1000 using human liver lysates, Western Blot (Transfected lysate): 1:1000-1:2000 detects a band at ~21.5kD using CEACAM21 transfected 293T lysate., Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQRRAPWS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.