Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R32480 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Cell division protein kinase 6, also... more
Product information "Anti-Cdk6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Cell division protein kinase 6, also called Plstire, is an enzyme that in humans is encoded by the CDK6 gene. The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. Radiation hybrid analysis and inclusion within a mapped clone place the CDK6 gene at 7q21. Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation and promotes G1/S transition. This gene also involved in initiation and maintenance of cell cycle exit during cell differentiation. It prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types. In addition, CDK6 plays a role in promoting the proliferation of beta-cells in pancreatic islets of Langerhans. Protein function: Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation, promotes G1/S transition. Phosphorylates pRB/RB1 and NPM1. Interacts with D-type G1 cyclins during interphase at G1 to form a pRB/RB1 kinase and controls the entrance into the cell cycle. Involved in initiation and maintenance of cell cycle exit during cell differentiation, prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types (e.g. erythroid and hematopoietic cells). Essential for cell proliferation within the dentate gyrus of the hippocampus and the subventricular zone of the lateral ventricles. Required during thymocyte development. Promotes the production of newborn neurons, probably by modulating G1 length. Promotes, at least in astrocytes, changes in patterns of gene expression, changes in the actin cytoskeleton including loss of stress fibers, and enhanced motility during cell differentiation. Prevents myeloid differentiation by interfering with RUNX1 and reducing its transcription transactivation activity, but promotes proliferation of normal myeloid progenitors. Delays senescence. Promotes the proliferation of beta-cells in pancreatic islets of Langerhans. May play a role in the centrosome organization during the cell cycle phases (PubMed:23918663). [The UniProt Consortium]
Keywords: | Anti-CDK6, Anti-CDKN6, EC=2.7.11.22, Anti-Cyclin-dependent kinase 6, Anti-Cell division protein kinase 6, Anti-Serine/threonine-protein kinase PLSTIRE, Cdk6 Antibody |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R32480 |
Properties
Application: | WB, IHC (paraffin) |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, rat |
Immunogen: | Amino acids TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN from the human protein |
Format: | Purified |
Database Information
KEGG ID : | K02091 | Matching products |
UniProt ID : | Q00534 | Matching products |
Gene ID | GeneID 1021 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed