Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
![Anti-Cd46](https://www.biomol.com/media/image/ab/8e/65/NSJ-R31841_600x600.jpg)
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-R31841 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD46 complement regulatory protein,also... more
Product information "Anti-Cd46"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD46 complement regulatory protein,also known as CD46 (cluster of differentiation 46) andMembrane Cofactor Protein,is aproteinwhich in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described. Protein function: May be involved in the fusion of the spermatozoa with the oocyte during fertilization. [The UniProt Consortium]
Keywords: | Anti-Mcp, Anti-Cd46, Anti-CD46, Anti-Membrane cofactor protein, Cd46 Antibody |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | R31841 |
Properties
Application: | WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | mouse |
Immunogen: | Amino acids ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK of mouse Cd46 were used as the immunogen for the Cd46 antibody. |
Format: | Purified |
Database Information
KEGG ID : | K04007 | Matching products |
UniProt ID : | O88174 | Matching products |
Gene ID | GeneID 17221 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | -20°C (International: -20°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed