Anti-Cd46

Anti-Cd46
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31841 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD46 complement regulatory protein,also... more
Product information "Anti-Cd46"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD46 complement regulatory protein,also known as CD46 (cluster of differentiation 46) andMembrane Cofactor Protein,is aproteinwhich in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described. Protein function: May be involved in the fusion of the spermatozoa with the oocyte during fertilization. [The UniProt Consortium]
Keywords: Anti-Mcp, Anti-Cd46, Anti-CD46, Anti-Membrane cofactor protein, Cd46 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31841

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse
Immunogen: Amino acids ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK of mouse Cd46 were used as the immunogen for the Cd46 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Cd46"
Write a review
or to review a product.
Viewed