Anti-CD1b

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4547 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD1b is a member of the CD1 family of... more
Product information "Anti-CD1b"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD1b is a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens. Protein function: Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells. [The UniProt Consortium]
Keywords: Anti-CD1B, Anti-CD1b, Anti-T-cell surface glycoprotein CD1b, CD1b Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4547

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids DKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY
Format: Antigen Presentation

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CD1b"
Write a review
or to review a product.
Viewed