Anti-CD19

Anti-CD19
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31973 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. B-lymphocyte antigen CD19, also known as... more
Product information "Anti-CD19"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. B-lymphocyte antigen CD19, also known as CD19 (Cluster of Differentiation 19), is a protein that in humans is encoded by the CD19 gene. It is found on the surface of B-cells, a type of white blood cell. Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. The CD19 gene encodes a cell surface molecule that assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. Protein function: Assembles with the antigen receptor of B-lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. [The UniProt Consortium]
Keywords: Anti-CD19, Anti-B-lymphocyte antigen CD19, Anti-Differentiation antigen CD19, Anti-T-cell surface antigen Leu-12, Anti-B-lymphocyte surface antigen B4, CD19 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31973

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids LVGILHLQRALVLRRKRKRMTDPTRRFFKVT of human CD19 were used as the immunogen for the anti-CD19 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CD19"
Write a review
or to review a product.
Viewed