Anti-CD18

Anti-CD18
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R30292 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The beta-2 integrin chain gene is... more
Product information "Anti-CD18"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the ôinside-outö signaling pathways. Protein function: Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha- D/beta-2 is a receptor for ICAM3 and VCAM1. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation. [The UniProt Consortium]
Keywords: Anti-CD18, Anti-ITGB2, Anti-Integrin beta-2, Anti-Complement receptor C3 subunit beta, Anti-Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta, CD18 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R30292

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: An amino acid sequence from the N-terminus of human CD18 (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD) was used as the immunogen for this CD18 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CD18"
Write a review
or to review a product.
Viewed