Anti-C Reactive Protein

Anti-C Reactive Protein
Anti-C Reactive Protein
Anti-C Reactive Protein
Anti-C Reactive Protein
%
Discount Promotion
Promotion:

Save 30% on all primary antibodies by Arigo Biolaboratories!

*1
*1 Offer expires 16/12/2024
Item number Size Datasheet Manual SDS Delivery time Quantity Discount Price
ARG40847.50 50 µg - -

6 - 14 business days*

30 %
520.00€
364.00€
 
Protein function: Displays several functions associated with host defense: it promotes... more
Product information "Anti-C Reactive Protein"
Protein function: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. [The UniProt Consortium]
Keywords: Anti-CRP, Anti-PTX1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40847

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Synthetic peptide corresponding to a sequence of Human CRP. (QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA)
MW: 25 kD

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-C Reactive Protein"
Write a review
or to review a product.
Viewed