Anti-ASL / Adenylosuccinate Lyase

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32857 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ASL (argininosuccinate lyase, also known... more
Product information "Anti-ASL / Adenylosuccinate Lyase"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ASL (argininosuccinate lyase, also known as argininosuccinase) is an enzyme that catalyzes the reversible breakdown of argininosuccinate (ASA) producing the amino acid arginine and dicarboxylic acid fumarate. Located in liver cytosol, ASL is the fourth enzyme of the urea cycle and involved in the biosynthesis of arginine in all species and the production of urea in ureotelic species. Mutations in ASL, resulting low activity of the enzyme, increase levels of urea in the body and result in various side effects. The ASL gene is located on chromosome 7 between the centromere (junction of the long and short arm) and the long (q) arm at position 11.2, from base pair 64,984,963 to base pair 65,002,090.
Keywords: Anti-ASL, Anti-ASAL, EC=4.3.2.1, Anti-Arginosuccinase, Anti-Argininosuccinate lyase, ASL Antibody / Adenylosuccinate Lyase
Supplier: NSJ Bioreagents
Supplier-Nr: R32857

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN were used as the immunogen for the ASL antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ASL / Adenylosuccinate Lyase"
Write a review
or to review a product.
Viewed