Anti-APLP1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32129 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Amyloid-precursor-like protein 1 (APLP1)... more
Product information "Anti-APLP1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Amyloid-precursor-like protein 1 (APLP1) is a membrane-associated glycoprotein, whose gene is homologous to the APP gene, which has been shown to be involved in the pathogenesis of Alzheimer's disease. APLP1 is predominantly expressed in brain, particularly in the cerebral cortex postsynaptic density. The human gene has been mapped to chromosomal region 19q13.1. The gene is 11.8 kb long and contains 17 exons. APLP1 has been considered a candidate gene for CNF. All exon regions of the gene were amplified by the polymerase chain reaction and sequenced from DNA of CNF patients. No differences were observed between CNF patients and controls, suggesting that mutations in APLP1 are not involved in the etiology of CNF. Protein function: May play a role in postsynaptic function. The C-terminal gamma-secretase processed fragment, ALID1, activates transcription activation through APBB1 (Fe65) binding. Couples to JIP signal transduction through C-terminal binding. May interact with cellular G-protein signaling pathways. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I. [The UniProt Consortium]
Keywords: Anti-APLP1, APLP1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32129

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids RRCLRDPQRVLEYCRQMYPELQIARVEQATQ of human APLP1 were used as the immunogen for the APLP1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-APLP1"
Write a review
or to review a product.
Anti-APLP1 Anti-APLP1
755.00€ *
Anti-APLP1 Anti-APLP1
From 71.00€ *
Anti-APLP1 Anti-APLP1
From 71.00€ *
-30 %
Discount Promotion
Anti-APLP1 Anti-APLP1
520.00€ * 364.00€ *
-30 %
Discount Promotion
Anti-APLP1 Anti-APLP1
624.00€ * 436.80€ *
Viewed