Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
![Anti-Angiotensin-converting enzyme (Ace)](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-RQ4007 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Angiotensin I converting enzyme (ACE),... more
Product information "Anti-Angiotensin-converting enzyme (Ace)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Protein function: Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. This GPIase activity seems to be crucial for the egg-binding ability of the sperm. [The UniProt Consortium]
Keywords: | Anti-Ace, Anti-Dcp1, EC=3.2.1.-, EC=3.4.15.1, Angiotensin-converting enzyme Antibody (Ace) |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | RQ4007 |
Properties
Application: | WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | mouse, rat |
Immunogen: | Amino acids AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR from the mouse protein were used as the immunogen for the Ace antibody. |
Format: | Purified |
Database Information
KEGG ID : | K01283 | Matching products |
UniProt ID : | P09470 | Matching products |
Gene ID | GeneID 11421 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed