Anti-AMHR2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32469 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. AMHR2 is the receptor for the... more
Product information "Anti-AMHR2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified. Protein function: On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for anti-Muellerian hormone. [The UniProt Consortium]
Keywords: Anti-MRII, Anti-AMHR, Anti-AMHR2, Anti-MISRII, EC=2.7.11.30, Anti-MIS type II receptor, Anti-AMH type II receptor, Anti-Anti-Muellerian hormone type-2 receptor, Anti-Anti-Muellerian hormone type II receptor, AMHR2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32469

Properties

Application: WB, IHC (paraffin), IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-AMHR2"
Write a review
or to review a product.
Viewed