Anti-AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript)

Anti-AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
A1059-62J.50 50 µl - -

3 - 19 business days*

659.00€
 
AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to... more
Product information "Anti-AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript)"
AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats. Applications Suitable for use in Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Frozen): 1:1000- :2000 , Optimal dilution determined by the researcher. Positive Control: Sheep brain (hypothalamus). No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP., , Storage and Stability: , Lyophilized powder may be stored at -20°C for short-term only. Reconstitute with sterile 40-50% glycerol, PBS. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Anti-Agouti-related protein
Supplier: United States Biological
Supplier-Nr: A1059-62J

Properties

Application: IHC
Antibody Type: Polyclonal
Conjugate: No
Host: Guinea Pig
Species reactivity: mouse, sheep
Immunogen: Synthetic peptide corresponding to aa 82-131, SPRRCVRLHESCLG QQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT a region within the carboxy domain of mouse agouti related protein.
Format: Serum

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript)"
Write a review
or to review a product.
Viewed