Anti-ADRA1A

Anti-ADRA1A
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32076 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ADRA1A, also known as alpha-1A adrenergic... more
Product information "Anti-ADRA1A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle. Protein function: This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes. [The UniProt Consortium]
Keywords: Anti-ADRA1A, Anti-ADRA1C, Anti-Alpha-1A adrenoceptor, Anti-Alpha-1A adrenoreceptor, Anti-Alpha-1A adrenergic receptor, Anti-Alpha-1C adrenergic receptor, Anti-Alpha-adrenergic receptor 1c, ADRA1A Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32076

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD of human ADRA1A were used as the immunogen for the ADRA1A antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ADRA1A"
Write a review
or to review a product.
Viewed