Anti-Aconitase 2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R32458	100 µg		-	-	3 - 10 business days*		772.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aconitase 2, mitochondrial is a protein... more

Close menu

Product information "Anti-Aconitase 2"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aconitase 2, mitochondrial is a protein that in humans is encoded by the ACO2 gene. The protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification. Protein function: Catalyzes the isomerization of citrate to isocitrate via cis- aconitate. [The UniProt Consortium]

Keywords:	Anti-ACO2, Anti-Aconitase, Anti-Citrate hydro-lyase, Anti-Aconitate hydratase, mitochondrial, Aconitase 2 Antibody
Supplier:	NSJ Bioreagents
Supplier-Nr:	R32458

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Amino acids TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDH from the human protein
Format:	Purified