Anti-ACAA2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32490 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 3-Ketoacyl-CoA thiolase, mitochondrial,... more
Product information "Anti-ACAA2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. 3-Ketoacyl-CoA thiolase, mitochondrial, also known as acetyl-Coenzyme A acyltransferase 2, is an acetyl-CoA C-acyltransferase enzyme that in humans is encoded by the ACAA2 gene. The ACAA2 gene encodes a 41.9 kDa protein that is composed of 397 amino acids and contains 88 observed peptides. The encoded protein catalyzes the last step of themitochondrial fatty acid beta oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. Additionally, ACAA2 has been shown to be a functional BNIP3 binding partner, which provides a possible link between fatty acid metabolism and cell apoptosis. Protein function: Abolishes BNIP3-mediated apoptosis and mitochondrial damage. [The UniProt Consortium]
Keywords: Anti-T1, Anti-ACAA2, EC=2.3.1.16, Anti-Beta-ketothiolase, Anti-Acetyl-CoA acyltransferase, Anti-Mitochondrial 3-oxoacyl-CoA thiolase, Anti-3-ketoacyl-CoA thiolase, mitochondrial, ACAA2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32490

Properties

Application: WB, IHC (paraffin), IF/ICC, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 207-242 (EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ACAA2"
Write a review
or to review a product.
Viewed