Anti-ABCC8 / SUR1

Anti-ABCC8 / SUR1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4054 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ATP-binding cassette transporter... more
Product information "Anti-ABCC8 / SUR1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene. Protein function: Subunit of the beta-cell ATP-sensitive potassium channel (KATP). Regulator of ATP-sensitive K(+) channels and insulin release. [The UniProt Consortium]
Keywords: Anti-HRINS, Anti-ABCC8, Anti-Sulfonylurea receptor 1, Anti-ATP-binding cassette sub-family C member 8, ABCC8 Antibody / SUR1
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4054

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA from the human protein were used as the immunogen for the SUR1 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ABCC8 / SUR1"
Write a review
or to review a product.
Anti-ABCC8 Anti-ABCC8
755.00€ *
Anti-ABCC8 Anti-ABCC8
From 71.00€ *
-30 %
Discount Promotion
Anti-SUR1 / ABCC8, C-terminal Anti-SUR1 / ABCC8, C-terminal
784.00€ * 548.80€ *
Viewed