Anti-ABCB10

Anti-ABCB10
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32456 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ABCB10, also known as M-ABC2, is expressed... more
Product information "Anti-ABCB10"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ABCB10, also known as M-ABC2, is expressed as a 65-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown. Protein function: May mediate critical mitochondrial transport functions related to heme biosynthesis. [The UniProt Consortium]
Keywords: Anti-M-ABC2, Anti-ABCB10, Anti-ABC transporter 10 protein, Anti-ATP-binding cassette transporter 10, Anti-Mitochondrial ATP-binding cassette 2, Anti-ATP-binding cassette sub-family B member 10, mitochondrial, ABCB10 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32456

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Amino acids 640-678 (QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ABCB10"
Write a review
or to review a product.
Viewed