Anti-12 Lipoxygenase

Anti-12 Lipoxygenase
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32691 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ALOX12 (Arachidonate 12-lipoxygenase) is... more
Product information "Anti-12 Lipoxygenase"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. ALOX12 (Arachidonate 12-lipoxygenase) is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12(S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis. Protein function: Catalyzes the regio and stereo-specific incorporation of molecular oxygen into free and esterified polyunsaturated fatty acids generating lipid hydroperoxides that can be further reduced to the corresponding hydroxy species (PubMed:17493578, PubMed:1851637, PubMed:8319693, PubMed:8500694, PubMed:18311922, PubMed:32404334). Mainly converts arachidonate ((5Z,8Z,11Z,14Z)-eicosatetraenoate) to the specific bioactive lipid (12S)-hydroperoxyeicosatetraenoate/(12S)-HPETE (PubMed:17493578, PubMed:22984144, PubMed:24282679, PubMed:8319693, PubMed:8500694). Through the production of bioactive lipids like (12S)- HPETE it regulates different biological processes including platelet activation (PubMed:8319693, PubMed:8500694). It can also catalyze the epoxidation of double bonds of polyunsaturated fatty acids such as (14S)-hydroperoxy-docosahexaenoate/(14S)-HPDHA resulting in the formation of (13S,14S)-epoxy-DHA (PubMed:23504711). Furthermore, it may participate in the sequential oxidations of DHA ((4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate) to generate specialized pro- resolving mediators (SPMs) like resolvin D5 ((7S,17S)-diHPDHA) and (7S,14S)-diHPDHA, that actively down-regulate the immune response and have anti-aggregation properties with platelets (PubMed:32404334). An additional function involves a multistep process by which it transforms leukotriene A4/LTA4 into the bioactive lipids lipoxin A4/LXA4 and lipoxin B4/LXB4, both are vasoactive and LXA4 may regulate neutrophil function via occupancy of specific recognition sites (PubMed:8250832). Can also peroxidize linoleate ((9Z,12Z)-octadecadienoate) to (13S)- hydroperoxyoctadecadienoate/ (13S-HPODE). Due to its role in regulating both the expression of the vascular endothelial growth factor (VEGF, an angiogenic factor involved in the survival and metastasis of solid tumors) and the expression of integrin beta-1 (known to affect tumor cell migration and proliferation), it can be regarded as protumorigenic (PubMed:9751607, PubMed:16638750, PubMed:22237009). Important for cell survival, as it may play a role not only in proliferation but also in the prevention of apoptosis in vascular smooth muscle cells (PubMed:23578768). [The UniProt Consortium]
Keywords: Anti-12LO, Anti-12S-LOX, EC=3.3.2.-, Anti-12S-lipoxygenase, Anti-Lipoxin synthase 12-LO, Anti-Linoleate (13S)-lipoxygenase, Anti-Platelet-type lipoxygenase 12, Anti-Arachidonate (12S)-lipoxygenase, Anti-Arachidonate (15S)-lipoxygenase, 12 Lipoxygenase Ant
Supplier: NSJ Bioreagents
Supplier-Nr: R32691

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids 186-231 ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-12 Lipoxygenase"
Write a review
or to review a product.
Viewed