11 products were found matching "GeneID 6232"!

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-84aa. Protein Length: Full Length. Tag Info: N-terminal GST-tagged. Target Protein Sequence: PLAKDLLHPS PEEEKRKHKK KRLVQSPNSY FMDVKCPGCY KITTVFSHAQ TVVLCVGCST VLCQPTGGKA RLTEGCSFRR KQH. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin:...

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: RPS27. Antigen Species: Human

Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: RPS27. Antigen Species: Human

0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Metallopanstimulin 1, RPS27, Ribosomal protein S27, RPS27

Length: 255 Sequence: atgcctctcg caaaggatct ccttcatccc tctccagaag aggagaagag gaaacacaag aagaaacgcc tggtgcagag ccccaattcc tacttcatgg atgtgaaatg cccaggatgc tataaaatca ccacggtctt tagccatgca caaacggtag ttttgtgtgt tggctgctcc actgtcctct gccagcctac aggaggaaaa gcaaggctta cagaaggatg ttccttcagg aggaagcagc Protein function:...

MPS1, also known as RPS27. It is a ribosomal protein. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. MPS1 is a component of the 40S subunit....

MPS1, also known as RPS27. It is a ribosomal protein. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. MPS1 is a component of the 40S subunit....

0.5mg/ml if reconstituted with 0.2ml sterile DI water. 40S ribosomal protein S27, also known as Metallopan-stimulin 1 or MPS-1, is a protein that in humans is encoded by the RPS27 gene. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these...

Source:, Recombinant protein corresponding to aa1-84 from human RPS27, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.3kD, AA Sequence: PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH, Storage and Stability: May be stored at 4°C for short-term only....

Protein function: Component of the small ribosomal subunit (PubMed:8706699). Required for proper rRNA processing and maturation of 18S rRNAs (PubMed:25424902). [The UniProt Consortium]