CMA1, Recombinant, Canine, aa22-249, His-Tag (Chymase)

CMA1, Recombinant, Canine, aa22-249, His-Tag (Chymase)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
372798.20 20 µg - -

3 - 19 business days*

675.00€
372798.100 100 µg - -

3 - 19 business days*

1,045.00€
 
Major secreted protease of mast cells with suspected roles in vasoactive peptide generation,... more
Product information "CMA1, Recombinant, Canine, aa22-249, His-Tag (Chymase)"
Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, Extracellular domain matrix degradation, and regulation of gland secretion. Source: Recombinant protein corresponding to aa22-249 from canine CMA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.4kD, AA Sequence: IIGGTESKPHSRPYMAHLEILTLRNHLASCGGFLIRRNFVLTAAHCAGRFIMVTLGAHNIQKKEDTWQKLEVIKQFPHPKYDDLTLRHDIMLLKLKEKANLTLAVGTLPLSPQFNFVPPGRMCRVAGWGKRQVNGSGSDTLQEVKLRLMDPQACRHYMAFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGQNDAKPPAVFTRISHYRPWINKVLKQNKA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: CMA1, Chymase, EC=3.4.21.39, Alpha-chymase, Mast cell protease I
Supplier: United States Biological
Supplier-Nr: 372798

Properties

Conjugate: No
MW: 27,4
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CMA1, Recombinant, Canine, aa22-249, His-Tag (Chymase)"
Write a review
or to review a product.
Viewed