Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
%
Discount Promotion
Promotion:
Save 30% on all primary antibodies by Arigo Biolaboratories!
*1
*1 Offer expires 16/12/2024
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Discount | Price |
---|---|---|---|---|---|---|---|---|
ARG40274.50 | 50 µl | - | - |
6 - 14 business days* |
30 %
|
520.00€
364.00€ |
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Protein function: High-affinity sodium/citrate cotransporter that mediates citrate entry into... more
Product information "Anti-SLC13A5"
Protein function: High-affinity sodium/citrate cotransporter that mediates citrate entry into cells. The transport process is electrogenic, it is the trivalent form of citrate rather than the divalent form that is recognized as a substrate. May facilitate the utilization of circulating citrate for the generation of metabolic energy and for the synthesis of fatty acids and cholesterol. [The UniProt Consortium]
Keywords: | Anti-NACT, Anti-NaCT, Anti-SLC13A5, Anti-Na(+)/citrate cotransporter, Anti-Solute carrier family 13 member 5, Anti-Sodium-coupled citrate transporter, Anti-Sodium-dependent citrate transporter |
Supplier: | Arigo Biolaboratories |
Supplier-Nr: | ARG40274 |
Properties
Application: | WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human (Expected: mouse, rat, cow, dog, guinea pig, horse, rabbit) |
Immunogen: | Synthetic peptide around the middle region of Human SLC13A5. (within the following region: CKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWF) |
MW: | 63 kD |
Format: | Affinity Purified |
Database Information
KEGG ID : | K14445 | Matching products |
UniProt ID : | Q86YT5 | Matching products |
Gene ID | GeneID 284111 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed