Anti-P Glycoprotein

Anti-P Glycoprotein
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4527 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. P-GP, also called ABCB1 or PGY1, is a... more
Product information "Anti-P Glycoprotein"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the bloodûbrain barrier. Protein function: Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells. [The UniProt Consortium]
Keywords: Anti-MDR1, Anti-ABCB1, Anti-CD243, EC=7.6.2.2, Anti-P-glycoprotein 1, Anti-Multidrug resistance protein 1, Anti-ATP-binding cassette sub-family B member 1, P Glycoprotein Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4527

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-P Glycoprotein"
Write a review
or to review a product.
-30 %
Discount Promotion
-30 %
Discount Promotion
Anti-MDR1 / P Glycoprotein 1 Anti-MDR1 / P Glycoprotein 1
624.00€ * 436.80€ *
-30 %
Discount Promotion
Anti-MDR1 / P Glycoprotein 1 Anti-MDR1 / P Glycoprotein 1
520.00€ * 364.00€ *
Viewed