Anti-GABARAPL1

Promotion:

Save 30% on all primary antibodies by Arigo Biolaboratories!

^*1

^*1 Offer expires 16/12/2024

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Discount	Price
ARG41411.50	50 µl		-	-	6 - 14 business days*		30 %	520.00€ 364.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Ubiquitin-like modifier that increases cell-surface expression of kappa-type... more

Close menu

Product information "Anti-GABARAPL1"

Protein function: Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (PubMed:16431922, PubMed:20404487). Through its interaction with the reticulophagy receptor TEX264, paticipates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538, PubMed:31006537). [The UniProt Consortium]

Keywords:	Anti-GEC1, Anti-GEC-1, Anti-GABARAPL1, Anti-Early estrogen-regulated protein, Anti-Glandular epithelial cell protein 1, Anti-GABA(A) receptor-associated protein-like 1, Anti-Gamma-aminobutyric acid receptor-associated protein-like 1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41411

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, cow, dog, guinea pig, horse, rabbit)
Immunogen:	Synthetic peptide around the N-terminal region of Human GABARAPL1. (within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL)
MW:	14 kD
Format:	Affinity Purified