Anti-ALDH1B1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R32505	100 µg		-	-	3 - 10 business days*		755.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aldehyde dehydrogenase X, mitochondrial is... more

Close menu

Product information "Anti-ALDH1B1"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems. Protein function: ALDHs play a major role in the detoxification of alcohol- derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. [The UniProt Consortium]

Keywords:	Anti-ALDH5, Anti-ALDH1B1, EC=1.2.1.3, Anti-Aldehyde dehydrogenase 5, Anti-Aldehyde dehydrogenase X, mitochondrial, Anti-Aldehyde dehydrogenase family 1 member B1, ALDH1B1 Antibody
Supplier:	NSJ Bioreagents
Supplier-Nr:	R32505

Properties

Application:	WB, IHC (paraffin), IF, FC
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat, monkey
Immunogen:	Amino acids 116-156 (RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKW from the human protein
Format:	Purified