Anti-ADSL / Adenylosuccinate Lyase

Anti-ADSL / Adenylosuccinate Lyase
Anti-ADSL / Adenylosuccinate Lyase
Anti-ADSL / Adenylosuccinate Lyase
     
%
Discount Promotion
Promotion:

Save 30% on all primary antibodies by Arigo Biolaboratories!

*1
*1 Offer expires 16/12/2024
Item number Size Datasheet Manual SDS Delivery time Quantity Discount Price
ARG58295.50 50 µg - -

6 - 14 business days*

30 %
520.00€
364.00€
 
This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic... more
Product information "Anti-ADSL / Adenylosuccinate Lyase"
This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Keywords: Anti-ASL, Anti-ASAL, EC=4.3.2.1, Anti-Arginosuccinase, Anti-Argininosuccinate lyase
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58295

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human Adenylosuccinate Lyase (YTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRIN)
MW: 52 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ADSL / Adenylosuccinate Lyase"
Write a review
or to review a product.
Viewed