Zu "Q9ULD4" wurden 8 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
BRPF3 (576-701), Human Recombinant Protein
BRPF3 (576-701), Human Recombinant Protein

Artikelnummer: BPS-31130

Human Bromodomain and PHD finger containing 3, or BRPF3, amino-acids 576 - 701 (GenBank Accession No. NM_015695) with N-terminal GST-tag, MW = 41.2 kDa, expressed in an E. coli expression system.
Schlagworte: Bromodomain and PHD finger-containing protein 3,
Anwendung: Bromodomain binding assays, inhibitor screening, selectivity profiling
Exprimiert in: E.coli
Ursprungsart: human
MW: 41.2 kD
461,00 €
Bewerten
BRPF3 TR-FRET Assay Kit
BRPF3 TR-FRET Assay Kit

Artikelnummer: BPS-32626

The BRPF3 TR-FRET Assay Kit is designed to measure the inhibition of BRPF3 binding to its substrate in a homogeneous 384 reaction format. This FRET-based assay requires no time-consuming washing steps, making it especially suitable for high throughput screening applications. The assay procedure is straightforward...
Schlagworte: Bromodomain and PHD finger-containing protein 3,
Anwendung: Small molecular inhibitor screening, drug discovery, HTS
Spezies-Reaktivität: human
1.563,00 €
Bewerten
Anti-BRPF3
Anti-BRPF3

Artikelnummer: ATA-HPA022787.100

Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:26620551, PubMed:26677226). Plays a role in DNA replication initiation by directing KAT7/HBO1 specificity...
Schlagworte: Anti-Bromodomain and PHD finger-containing protein 3
Anwendung: ICC, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 239,00 €
Bewerten
BRPF3 (human), recombinant protein
BRPF3 (human), recombinant protein

Artikelnummer: ABS-PP-2915.100

Schlagworte: Bromodomain and PHD finger-containing protein 3, Recombinant Human BRPF3 Protein
MW: 21 kD
ab 90,00 €
Bewerten
BRPF3 (Vector pUC, Accession No. BC117387)
BRPF3 (Vector pUC, Accession No. BC117387)

Artikelnummer: CSB-CL890928HU.10

Length: 2808 Sequence: atgaggaagc ctcgtcggaa gtcccggcag aatgccgagg gccggcgttc cccgtccccc tacagtctca agtgctcacc cacccgggag accctgacat atgcccaggc ccagcggatt gtcgaggtag acattgatgg acgcctgcat cgtatcagca tctatgaccc actcaaaatc attactgaag atgagctaac tgcccaggat atcaccgaat gcaatagtaa caaggaaaac agtgaacagc ctcagttccc...
Schlagworte: Bromodomain and PHD finger-containing protein 3
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
1.018,00 €
Bewerten
BRPF3, Recombinant, Human, aa576-701, GST-tag (Bromodomain and PHD Finger Containing 3)
BRPF3, Recombinant, Human, aa576-701, GST-tag...

Artikelnummer: 298384.100

Source:, Recombinant protein corresponding to a single bromodomain, aa576-701, from human Bromodomain and PHD finger containing 3, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.2kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI,...
Schlagworte: BRPF3, KIAA1286, Bromodomain and PHD finger-containing protein 3
MW: 41,2
937,00 €
Bewerten
BRPF3 TR-FRET, BioAssay(TM) Kit (KIAA1286)
BRPF3 TR-FRET, BioAssay(TM) Kit (KIAA1286)

Artikelnummer: 298383.1

Kit comes in a convenient format with purified BRPF3 protein, ligands, Tb donor, dye-labeled acceptor, assay buffer and microtiter plate to perform 384 reactions. The BRPF3 TR-FRET BioAssay(TM) Kit is designed to measure the inhibition of BRPF3 binding to its substrate in a homogeneous 384 reaction format. This...
Schlagworte: Bromodomain and PHD finger-containing protein 3
Anwendung: FRET, Assays
Spezies-Reaktivität: human
1.898,00 €
Bewerten
BRPF3 PrEST Antigen
BRPF3 PrEST Antigen

Artikelnummer: ATA-APrEST86913.100

Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:26620551, PubMed:26677226). Plays a role in DNA replication initiation by directing KAT7/HBO1 specificity...
Schlagworte: Bromodomain and PHD finger-containing protein 3
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
265,00 €
Bewerten