- Suchergebnis für Q9ULD4
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9ULD4" wurden 8 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: BPS-31130
Human Bromodomain and PHD finger containing 3, or BRPF3, amino-acids 576 - 701 (GenBank Accession No. NM_015695) with N-terminal GST-tag, MW = 41.2 kDa, expressed in an E. coli expression system.
Schlagworte: | Bromodomain and PHD finger-containing protein 3, |
Anwendung: | Bromodomain binding assays, inhibitor screening, selectivity profiling |
Exprimiert in: | E.coli |
Ursprungsart: | human |
MW: | 41.2 kD |
461,00 €
Artikelnummer: BPS-32626
The BRPF3 TR-FRET Assay Kit is designed to measure the inhibition of BRPF3 binding to its substrate in a homogeneous 384 reaction format. This FRET-based assay requires no time-consuming washing steps, making it especially suitable for high throughput screening applications. The assay procedure is straightforward...
Schlagworte: | Bromodomain and PHD finger-containing protein 3, |
Anwendung: | Small molecular inhibitor screening, drug discovery, HTS |
Spezies-Reaktivität: | human |
1.563,00 €
Artikelnummer: ATA-HPA022787.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:26620551, PubMed:26677226). Plays a role in DNA replication initiation by directing KAT7/HBO1 specificity...
Schlagworte: | Anti-Bromodomain and PHD finger-containing protein 3 |
Anwendung: | ICC, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 239,00 €

Artikelnummer: ABS-PP-2915.100
Schlagworte: | Bromodomain and PHD finger-containing protein 3, Recombinant Human BRPF3 Protein |
MW: | 21 kD |
ab 90,00 €

Artikelnummer: CSB-CL890928HU.10
Length: 2808 Sequence: atgaggaagc ctcgtcggaa gtcccggcag aatgccgagg gccggcgttc cccgtccccc tacagtctca agtgctcacc cacccgggag accctgacat atgcccaggc ccagcggatt gtcgaggtag acattgatgg acgcctgcat cgtatcagca tctatgaccc actcaaaatc attactgaag atgagctaac tgcccaggat atcaccgaat gcaatagtaa caaggaaaac agtgaacagc ctcagttccc...
Schlagworte: | Bromodomain and PHD finger-containing protein 3 |
Anwendung: | Molecular biology, clone |
Spezies-Reaktivität: | human |
1.018,00 €

Artikelnummer: 298384.100
Source:, Recombinant protein corresponding to a single bromodomain, aa576-701, from human Bromodomain and PHD finger containing 3, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.2kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI,...
Schlagworte: | BRPF3, KIAA1286, Bromodomain and PHD finger-containing protein 3 |
MW: | 41,2 |
937,00 €

Artikelnummer: 298383.1
Kit comes in a convenient format with purified BRPF3 protein, ligands, Tb donor, dye-labeled acceptor, assay buffer and microtiter plate to perform 384 reactions. The BRPF3 TR-FRET BioAssay(TM) Kit is designed to measure the inhibition of BRPF3 binding to its substrate in a homogeneous 384 reaction format. This...
Schlagworte: | Bromodomain and PHD finger-containing protein 3 |
Anwendung: | FRET, Assays |
Spezies-Reaktivität: | human |
1.898,00 €

Artikelnummer: ATA-APrEST86913.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:26620551, PubMed:26677226). Plays a role in DNA replication initiation by directing KAT7/HBO1 specificity...
Schlagworte: | Bromodomain and PHD finger-containing protein 3 |
Anwendung: | Control antigen |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €