Zu "Q9UJU3" wurden 5 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZNF112
Artikelnummer: ATA-HPA076887.100
Polyclonal Antibody against Human ZNF112, Gene description: zinc finger protein 112, Alternative Gene Names: ZFP112, ZNF228, Validated applications: ICC, Uniprot ID: Q9UJU3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional...
| Schlagworte: | Anti-ZFP112, Anti-ZNF112, Anti-Zfp-112, Anti-Zinc finger protein 112, Anti-Zinc finger protein 228 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
ZNF112 (human), recombinant protein
Artikelnummer: ABS-PP-3468.100
| Schlagworte: | Zinc finger protein 112, Zfp-112, Zinc finger protein 228, Recombinant Human ZNF112 Protein |
| MW: | 28.5 kD |
ab 90,00 €
ZNF112 PrEST Antigen
Artikelnummer: ATA-APrEST95699.100
PrEST Antigen ZNF112, Gene description: zinc finger protein 112, Alternative Gene Names: ZFP112, ZNF228, Antigen sequence: SVSWLSHHNDKLEVHRKENYSCHDCGEDIMKVSLLNQESIQTEEKPYPCTGYRKAFSNDSSSEVHQQFHLEGKPYTYSSCGKGC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved...
| Schlagworte: | ZNF112, ZFP112, Zfp-112, Zinc finger protein 112, Zinc finger protein 228 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €
ZNF228, Human, Real Time PCR Primer Set
Artikelnummer: VHPS-10208
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | ZNF228, ZFP112, Zfp-112, Zinc finger protein 228, Zinc finger protein 112 homolog |
| Anwendung: | RNA quantification |
44,00 €
Anti-ZF112
Artikelnummer: ELK-ES12214.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Nucleus .
| Schlagworte: | Anti-ZFP112, Anti-ZNF112, Anti-Zfp-112, Anti-Zinc finger protein 112, Anti-Zinc finger protein 228, ZF112 rabbit pAb |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
