- Suchergebnis für Q9P0L9
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9P0L9" wurden 13 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA070002.100
Polyclonal Antibody against Human PKD2L1, Gene description: polycystin 2 like 1, transient receptor potential cation channel, Alternative Gene Names: PCL, PKD2L, PKDL, TRPP3, Validated applications: ICC, Uniprot ID: Q9P0L9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
477,00 €
Artikelnummer: CSB-PA214505.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PKD2L1. Antigen Species: Human
Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA960366.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PKD2L1. Antigen Species: Human
Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: DIM-FLP100773.10
This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation...
Schlagworte: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
Anwendung: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
Exprimiert in: | Human cells |
Ursprungsart: | human |
MW: | 92 kD |
ab 1.291,00 €

Artikelnummer: DIM-FLP120773.10
This gene encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation...
Schlagworte: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
Anwendung: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
Exprimiert in: | Human cells |
Ursprungsart: | human |
MW: | 92 kD |
ab 1.162,00 €

Artikelnummer: ABS-PP-5501.100
Schlagworte: | Polycystin-2-like protein 1, Polycystin-2L1, Polycystic kidney disease 2-like 1 protein, Polycystin-2 homolog,... |
MW: | 29.5 kD |
ab 90,00 €

Artikelnummer: ATA-APrEST96085.100
PrEST Antigen PKD2L1, Gene description: polycystin 2 like 1, transient receptor potential cation channel, Alternative Gene Names: PCL, PKD2L, PKDL, TRPP3, Antigen sequence: YNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Schlagworte: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €

Artikelnummer: CSB-PA018062GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PKD2L1. Antigen Species: Human
Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
552,00 €

Artikelnummer: CSB-PA865199DSR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PKD2L1. Antigen Species: Human
Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-CL865199HU.10
Length: 2418 Sequence: atgaatgctg tgggaagtcc tgaggggcag gagctgcaaa agctggggag tggagcctgg gacaaccccg cctacagtgg tcccccttcc ccacacggga cgctgagagt ctgcaccatc tccagcacgg ggcctctcca gccccaaccc aagaagcctg aagatgaacc ccaggagacg gcatacagga cccaggtgtc cagctgctgc ctccatatct gtcaaggcat cagaggactt tggggaacaa ccctgactga...
Schlagworte: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
Anwendung: | Molecular biology, clone |
Spezies-Reaktivität: | human |
879,00 €

Artikelnummer: VHPS-6930
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | PKD2L, PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
Anwendung: | RNA quantification |
44,00 €

Artikelnummer: 040096.200
PKD2L1 is a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation channel....
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
767,00 €