- Suchergebnis für Q9NYT6
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9NYT6" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA069192.100
Polyclonal Antibody against Human ZNF226, Gene description: zinc finger protein 226, Validated applications: IHC, Uniprot ID: Q9NYT6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]...
Schlagworte: | Anti-ZNF226, Anti-Zinc finger protein 226 |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
477,00 €
Artikelnummer: G-PACO31216.50
ZNF226 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. ZNF226 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
Schlagworte: | Anti-ZNF226, Anti-Zinc finger protein 226 |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
384,00 €
Artikelnummer: ATA-HPA006145.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 44% and to rat: 47%
Schlagworte: | Anti-ZNF226, Anti-Zinc finger protein 226 |
Anwendung: | ICC, IHC, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 358,00 €

Artikelnummer: ABS-PP-2853.100
Schlagworte: | Zinc finger protein 226, Recombinant Human ZNF226 Protein |
MW: | 16 kD |
ab 90,00 €

Artikelnummer: ATA-APrEST96237.100
PrEST Antigen ZNF226, Gene description: zinc finger protein 226, Antigen sequence: QRLNRDQQISIKNKLCQCKKGVDPIGWISHHDGHRVHKSEKSYRPNDYEKDNMKILTFDHNSMIHTGHK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]...
Schlagworte: | ZNF226, Zinc finger protein 226 |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €

Artikelnummer: CSB-PA026594LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF226. Antigen Species: Human
Schlagworte: | Anti-ZNF226, Anti-Zinc finger protein 226, ZNF226Zinc finger protein 226 antibody, ZNF226 Antibody |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA026594LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF226. Antigen Species: Human
Schlagworte: | Anti-ZNF226, Anti-Zinc finger protein 226, ZNF226Zinc finger protein 226 antibody, ZNF226 Antibody, HRP conjugated |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA026594LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF226. Antigen Species: Human
Schlagworte: | Anti-ZNF226, Anti-Zinc finger protein 226, ZNF226Zinc finger protein 226 antibody, ZNF226 Antibody, Biotin conjugated |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA026594LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF226. Antigen Species: Human
Schlagworte: | Anti-ZNF226, Anti-Zinc finger protein 226, ZNF226Zinc finger protein 226 antibody, ZNF226 Antibody, FITC conjugated |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-CL026594HU.10
Length: 285 Sequence: atgaatatgt tcaaggaagc agtgaccttc aaggacgtgg ctgtggcctt cacggaggag gaattggggc tgctgggccc tgcccagagg aagctgtacc gagatgtgat ggtggagaac tttaggaacc tgctgtcagt ggggcatcca cccttcaaac aagatgtatc acctatagaa agaaatgagc agctttggat aatgacgaca gcaacccgaa gacagggaaa tttagatacc ttacttgtaa aagctctttt...
Schlagworte: | ZNF226, Zinc finger protein 226 |
Anwendung: | Molecular biology, clone |
Spezies-Reaktivität: | human |
176,00 €

Artikelnummer: VHPS-10207
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | ZNF226, Zinc finger protein 226 |
Anwendung: | RNA quantification |
44,00 €

Artikelnummer: ATA-APrEST83534.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: | ZNF226, Zinc finger protein 226 |
Anwendung: | Control antigen |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €