- Suchergebnis für Q9NSI6
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9NSI6" wurden 16 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ARG57407.100
Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium]
Schlagworte: | Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1 |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
624,00 €
Artikelnummer: BPS-31115
Human bromodomain and WD repeat domain containing 1 (BRWD1) or WDR9, amino-acids 1308 - 1436, (GenBank Accession No. NM_018963) with N-terminal HIS-tag, MW = 16.2 kDa, expressed in an E. coli expression system.
Schlagworte: | BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1, |
Anwendung: | BRD binding assays, inhibitor screening, selectivity profiling |
Exprimiert in: | E.coli |
Ursprungsart: | human |
MW: | 16.2 kD |
452,00 €
Artikelnummer: BPS-31135
Human bromodomain and WD repeat domain containing 1 (BRWD1) or WDR9, amino acids 1308 - 1436, (GenBank Accession No. NM_018963) with N-terminal GST-tag, MW = 42 kDa, expressed in an E. coli expression system.
Schlagworte: | BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1, |
Anwendung: | Bromodomain binding assays, screening inhibitors, selectivity profiling |
Exprimiert in: | E.coli |
Ursprungsart: | human |
MW: | 42 kD |
452,00 €
Artikelnummer: E-AB-64293.120
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD) residues which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a...
Schlagworte: | Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1,... |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
ab 198,00 €
Artikelnummer: G-PACO20872.50
BRWD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, IHC applications. BRWD1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a...
Schlagworte: | Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1 |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
363,00 €
Artikelnummer: G-PACO20873.50
BRWD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, IHC applications. BRWD1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a...
Schlagworte: | Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1 |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
363,00 €
Artikelnummer: ATA-HPA030943.100
Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...
Schlagworte: | Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1 |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 335,00 €
Artikelnummer: ATA-HPA030944.100
Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...
Schlagworte: | Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1 |
Anwendung: | ICC, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 335,00 €
Artikelnummer: ATA-HPA030945.100
Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...
Schlagworte: | Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1 |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
446,00 €
![C21orf107, Human, Real Time PCR Primer Set C21orf107, Human, Real Time PCR Primer Set](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Artikelnummer: VHPS-1223
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1 |
Anwendung: | RNA quantification |
43,00 €
![WDR9 (BD2), Recombinant, Human, aa1308-1436, GST-tag (Bromodomain and WD Repeat Domain Containing 1, WDR9 (BD2), Recombinant, Human, aa1308-1436, GST-tag (Bromodomain and WD Repeat Domain Containing 1,](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Artikelnummer: 298491.100
Source:, Recombinant protein corresponding to bromodomain 2, aa1308-1436, from human WDR9, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI, DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK,...
Schlagworte: | BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1 |
MW: | 42 |
916,00 €
![WDR9 (BD2), Recombinant, Human, aa1308-1436, His-Tag (Bromodomain and WD Repeat Domain Containing 1, WDR9 (BD2), Recombinant, Human, aa1308-1436, His-Tag (Bromodomain and WD Repeat Domain Containing 1,](/custom/plugins/NetiThemeBiomol/Resources/Themes/Frontend/Biomol/frontend/_public/src/img/no-picture.jpg)
Artikelnummer: 298492.100
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD) residues which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a...
Schlagworte: | BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1 |
MW: | 16,2 |
916,00 €