Zu "Q9NSI6" wurden 16 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-BRWD1 / WDR9
Anti-BRWD1 / WDR9

Artikelnummer: ARG57407.100

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium]
Schlagworte: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
624,00 €
Bewerten
WRD9 (1308-1436), human recombinant protein, N-terminal His tag
WRD9 (1308-1436), human recombinant protein, N-terminal...

Artikelnummer: BPS-31115

Human bromodomain and WD repeat domain containing 1 (BRWD1) or WDR9, amino-acids 1308 - 1436, (GenBank Accession No. NM_018963) with N-terminal HIS-tag, MW = 16.2 kDa, expressed in an E. coli expression system.
Schlagworte: BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1,
Anwendung: BRD binding assays, inhibitor screening, selectivity profiling
Exprimiert in: E.coli
Ursprungsart: human
MW: 16.2 kD
452,00 €
Bewerten
WDR9 (BRWD1), human recombinant protein, N-terminal GST-tag
WDR9 (BRWD1), human recombinant protein, N-terminal GST-tag

Artikelnummer: BPS-31135

Human bromodomain and WD repeat domain containing 1 (BRWD1) or WDR9, amino acids 1308 - 1436, (GenBank Accession No. NM_018963) with N-terminal GST-tag, MW = 42 kDa, expressed in an E. coli expression system.
Schlagworte: BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1,
Anwendung: Bromodomain binding assays, screening inhibitors, selectivity profiling
Exprimiert in: E.coli
Ursprungsart: human
MW: 42 kD
452,00 €
Bewerten
Anti-BRWD1
Anti-BRWD1

Artikelnummer: E-AB-64293.120

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD) residues which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a...
Schlagworte: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1,...
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 198,00 €
Bewerten
Anti-BRWD1
Anti-BRWD1

Artikelnummer: G-PACO20872.50

BRWD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, IHC applications. BRWD1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a...
Schlagworte: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
363,00 €
Bewerten
Anti-BRWD1
Anti-BRWD1

Artikelnummer: G-PACO20873.50

BRWD1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse and for use in ELISA, IHC applications. BRWD1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a...
Schlagworte: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1
Anwendung: ELISA, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
363,00 €
Bewerten
Anti-BRWD1
Anti-BRWD1

Artikelnummer: ATA-HPA030943.100

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...
Schlagworte: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 335,00 €
Bewerten
Anti-BRWD1
Anti-BRWD1

Artikelnummer: ATA-HPA030944.100

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...
Schlagworte: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1
Anwendung: ICC, IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 335,00 €
Bewerten
Anti-BRWD1
Anti-BRWD1

Artikelnummer: ATA-HPA030945.100

Protein function: May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as...
Schlagworte: Anti-BRWD1, Anti-C21orf107, Anti-WD repeat-containing protein 9, Anti-Bromodomain and WD repeat-containing protein 1
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
446,00 €
Bewerten
C21orf107, Human, Real Time PCR Primer Set
C21orf107, Human, Real Time PCR Primer Set

Artikelnummer: VHPS-1223

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1
Anwendung: RNA quantification
43,00 €
Bewerten
WDR9 (BD2), Recombinant, Human, aa1308-1436, GST-tag (Bromodomain and WD Repeat Domain Containing 1,
WDR9 (BD2), Recombinant, Human, aa1308-1436, GST-tag...

Artikelnummer: 298491.100

Source:, Recombinant protein corresponding to bromodomain 2, aa1308-1436, from human WDR9, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI, DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK,...
Schlagworte: BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1
MW: 42
916,00 €
Bewerten
WDR9 (BD2), Recombinant, Human, aa1308-1436, His-Tag (Bromodomain and WD Repeat Domain Containing 1,
WDR9 (BD2), Recombinant, Human, aa1308-1436, His-Tag...

Artikelnummer: 298492.100

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD) residues which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a...
Schlagworte: BRWD1, C21orf107, WD repeat-containing protein 9, Bromodomain and WD repeat-containing protein 1
MW: 16,2
916,00 €
Bewerten
1 von 2 Seiten