Zu "Q9BXU1" wurden 15 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-STK31
Artikelnummer: ATA-HPA072896.100
Polyclonal Antibody against Human STK31, Gene description: serine/threonine kinase 31, Alternative Gene Names: SgK396, TDRD8, Validated applications: IHC, Uniprot ID: Q9BXU1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 85% Rat gene identity: 85%
| Schlagworte: | Anti-STK31, Anti-SGK396, Anti-SgK396, EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
Anti-STK31
Artikelnummer: ATA-HPA023194.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 84% and to rat: 84%
| Schlagworte: | Anti-STK31, Anti-SGK396, Anti-SgK396, EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 358,00 €
STK31 (human), recombinant protein
Artikelnummer: ABS-PP-7292.100
| Schlagworte: | Serine/threonine-protein kinase 31, Serine/threonine-protein kinase NYD-SPK, Sugen kinase 396, SgK396, Recombinant Human... |
| MW: | 47.5 kD |
ab 90,00 €
STK31 PrEST Antigen
Artikelnummer: ATA-APrEST95905.100
PrEST Antigen STK31, Gene description: serine/threonine kinase 31, Alternative Gene Names: SgK396, TDRD8, Antigen sequence: DTHYDKVEDVVGSHIEDAVTFWAQSINRNKDIMKIGCSLSEVCPQASSVLGNLDPNKIYGGLFSEDQCWYRCKVLKIISVEKCLVRYIDYGNTEILNRSDIVEIPLELQFSSVAKKYKLWGLH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Schlagworte: | STK31, SgK396, SGK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €
STK31 (Vector pUC, Accession No. BC059374)
Artikelnummer: CSB-CL861165HU.10
Length: 3060 Sequence: atgtgggtcc agggtcactc ttctagagct tccgcaacgg aaagtgtgag tttttcagga attgttcaaa tggatgaaga tacacattac gataaagtgg aagatgtggt tggaagtcac atagaagatg cagtaacatt ttgggcccag agtatcaata gaaataagga tatcatgaag attggttgct cactgtctga agtttgcccc cacgccagtt cagttttggg gaatcttgac ccaaacaaga tttatggtgg...
| Schlagworte: | STK31, SGK396, SgK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
1.273,00 €
STK31 protein-GST fusion
Artikelnummer: 009-001-T62S
Recombinant human STK31 (496-end) was expressed by baculovirus in Sf9 insect cell using an N-Terminal Glutathione-S-Transferase fusion protein. The purity was determined to be >80% by densitometry.
| Schlagworte: | STK31, SGK396, SgK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
| Anwendung: | WB |
| Exprimiert in: | Human |
494,00 €
STK31, Human serine/threonine kinase 31, Real Time PCR...
Artikelnummer: VHPS-8950
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | STK31, SgK396, SGK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
| Anwendung: | RNA quantification |
44,00 €
Anti-STK31, CT (Serine/Threonine-protein Kinase 31,...
Artikelnummer: S4283-48.200
This gene is similar to a mouse gene that encodes a putative protein kinase with a tudor domain, and shows testis-specific expression. Alternative splicing results in multiple transcript variants encoding different isoforms. Applications: Suitable for use in ELISA, Western Blot, and Immunohistochemistry. Other...
| Schlagworte: | EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31, Anti-Serine/threonine-protein kinase NYD-SPK |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
767,00 €
Anti-STK31, NT (Serine/Threonine-protein Kinase 31,...
Artikelnummer: S4283-48A.200
This gene is similar to a mouse gene that encodes a putative protein kinase with a tudor domain, and shows testis-specific expression. Alternative splicing results in multiple transcript variants encoding different isoforms. Applications: Suitable for use in ELISA, Western Blot, and Immunohistochemistry. Other...
| Schlagworte: | EC=2.7.11.1, Anti-Sugen kinase 396, Anti-Serine/threonine-protein kinase 31, Anti-Serine/threonine-protein kinase NYD-SPK |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat |
767,00 €
Anti-STK31 (Serine/threonine-Protein Kinase 31,...
Artikelnummer: 226099.100
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 698,00 €
Human STK31 (Serine/threonine-protein kinase 31) ELISA...
Artikelnummer: G-HUFI06292.96
Human STK31 (Serine/threonine-protein kinase 31) ELISA Kit from Assay Genie is a pre-coated immunoassay with a high sensitivity and broad range and has been designed to measure Human STK31 (Serine/threonine-protein kinase 31) in serum, plasma & cell culture supernatant samples. The Human STK31...
| Schlagworte: | STK31, SgK396, SGK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
| Anwendung: | Sandwich ELISA |
| Spezies-Reaktivität: | human |
641,00 €
STK31 PrEST Antigen
Artikelnummer: ATA-APrEST75127.100
Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | STK31, SGK396, SgK396, EC=2.7.11.1, Sugen kinase 396, Serine/threonine-protein kinase 31, Serine/threonine-protein kinase... |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €