- Suchergebnis für Q96JL9
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q96JL9" wurden 16 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA077662.100
Polyclonal Antibody against Human ZNF333, Gene description: zinc finger protein 333, Alternative Gene Names: KIAA1806, Validated applications: ICC, Uniprot ID: Q96JL9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional...
Schlagworte: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333 |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
477,00 €
Artikelnummer: ARG40063.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
Schlagworte: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333 |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
658,00 €
Artikelnummer: ATA-HPA043973.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 31% and to rat: 31%
Schlagworte: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333 |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 358,00 €
Artikelnummer: ATA-HPA054680.100
Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 28% and to rat: 25%
Schlagworte: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333 |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 239,00 €

Artikelnummer: ABS-PP-2631.100
Schlagworte: | Zinc finger protein 333, Recombinant Human ZNF333 Protein |
MW: | 15.5 kD |
ab 90,00 €

Artikelnummer: ATA-APrEST95831.100
PrEST Antigen ZNF333, Gene description: zinc finger protein 333, Alternative Gene Names: KIAA1806, Antigen sequence: QCQPQEAIPSQDTFTEILSIDVKGEQPQPGEKLYKYNELEKPFNSIEPLFQYQRIHAGEASCECQEIRNSFFQSAHLIVPEKIRSGDKSYACNKCE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be...
Schlagworte: | ZNF333, KIAA1806, Zinc finger protein 333 |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €

Artikelnummer: CSB-PA026681LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF333. Antigen Species: Human
Schlagworte: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333, ZNF333 antibody, KIAA1806 antibody, Zinc finger protein 333... |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA026681LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF333. Antigen Species: Human
Schlagworte: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333, ZNF333 antibody, KIAA1806 antibody, Zinc finger protein 333... |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA026681LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF333. Antigen Species: Human
Schlagworte: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333, ZNF333 antibody, KIAA1806 antibody, Zinc finger protein 333... |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-PA026681LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF333. Antigen Species: Human
Schlagworte: | Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333, ZNF333 antibody, KIAA1806 antibody, Zinc finger protein 333... |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €

Artikelnummer: CSB-CL026681HU1.10
Length: 549 Sequence: atggaatccg tcacctttga ggatgtggcc gtggagttca tccaggagtg ggcattgctg gacagcgcac ggaggagcct gtgcaaatac aggatgcttg accagtgcag gaccctggcc tccaggggaa ctccaccatg caaacccagt tgtgtctccc agctggggca aagagcagag ccaaaggcaa cagaacgagg gattctccgt gccacaggtg ttgcctggga atctcaactt aaacccgaag agttgccttc...
Schlagworte: | ZNF333, KIAA1806, Zinc finger protein 333 |
Anwendung: | Molecular biology, clone |
Spezies-Reaktivität: | human |
176,00 €

Artikelnummer: CSB-CL026681HU2.10
Length: 912 Sequence: atggaatccg tcacctttga ggatgtggcc gtggagttca tccaggagtg ggcattgctg gacagcgcac ggaggagcct gtgcaaatac aggatgcttg accagtgcag gaccctggcc tccaggggaa ctccaccatg caaacccagt tgtgtctccc agctggggca aagagcagag ccaaaggcaa cagaacgagg gattctccgt gccacaggtg ttgcctggga atctcaactt aaacccgaag agttgccttc...
Schlagworte: | ZNF333, KIAA1806, Zinc finger protein 333 |
Anwendung: | Molecular biology, clone |
Spezies-Reaktivität: | human |
343,00 €