Zu "Q969S8" wurden 29 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-HDAC10
Artikelnummer: ATA-HPA019662.100
Polyclonal Antibody against Human HDAC10, Gene description: histone deacetylase 10, Alternative Gene Names: DKFZP761B039, Validated applications: ICC, WB, Uniprot ID: Q969S8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Polyamine deacetylase (PDAC),...
| Schlagworte: | Anti-HD10, Anti-HDAC10, Anti-Histone deacetylase 10, Anti-Polyamine deacetylase HDAC10 |
| Anwendung: | WB, ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
HDAC10 (human, recombinant)
Artikelnummer: Cay42085-50
Histone deacetylase 10 (HDAC10) is a zinc-dependent metalloenzyme and class IIb HDAC. It is composed of an N-terminal catalytic domain and a C-terminal leucine-rich domain. HDAC10 is ubiquitously expressed and shuttles between the cytoplasm and nucleus. It acts as a transcriptional corepressor and deacetylates...
| Schlagworte: | HD10, HD10, HDAC10, Histone deacetylase 10, Histone deacetylase 10, Polyamine deacetylase HDAC10, Polyamine deacetylase... |
| Exprimiert in: | Insect cells |
| Ursprungsart: | human |
561,00 €
Polyamine deacetylase HDAC10 (HDAC10), human, recombinant
Artikelnummer: CSB-EP010236HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-669aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MGTALVYHED MTATRLLWDD PECEIERPER LTAALDRLRQ RGLEQRCLRL SAREASEEEL GLVHSPEYVS LVRETQVLGK EELQALSGQF DAIYFHPSTF HCARLAAGAG LQLVDAVLTG AVQNGLALVR...
| Schlagworte: | HD10, HDAC10, Histone deacetylase 10, Polyamine deacetylase HDAC10, Recombinant Human Polyamine deacetylase HDAC10 (HDAC10) |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 75.5 kD |
ab 247,00 €
Anti-HDAC10
Artikelnummer: CSB-PA002914.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | Anti-HD10, Anti-HDAC10, Anti-Histone deacetylase 10, Anti-Polyamine deacetylase HDAC10, DKFZP761B039 antibody, HD 10... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat, monkey |
ab 126,00 €
Anti-HDAC10
Artikelnummer: CSB-PA249520.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Schlagworte: | Anti-HD10, Anti-HDAC10, Anti-Histone deacetylase 10, Anti-Polyamine deacetylase HDAC10, DKFZP761B039 antibody, HD 10... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
283,00 €
HDAC-10 (FLAG), active human recombinant protein
Artikelnummer: BPS-50060
Active human HDAC10 (a.a. 2-631) (GenBank Accession No. NM_032019) with N-terminal FLAG-tag, MW= 67 kDa, expressed in Sf9 cells via a baculovirus expression system
| Schlagworte: | HD10, HDAC10, Histone deacetylase 10, Polyamine deacetylase HDAC10, |
| Anwendung: | Enzyme kinetics, inhibitor screening, profiling |
| MW: | 67 kD |
618,00 €
Anti-HDAC10
Artikelnummer: 600-401-J75
Anti-HDAC10 was affinity purified from monospecific antiserum by immunoaffinity chromatography. A BLAST analysis was used to suggest cross-reactivity with human based on 100% sequence homology. Cross-reactivity with HDAC10 from other sources has not been determined. HDAC10 is located in the nucleus and cytoplasm,...
| Schlagworte: | Anti-HD10, Anti-HDAC10, EC=3.5.1.98, Anti-Histone deacetylase 10 |
| Anwendung: | ELISA, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
719,00 €
Anti-HDAC10
Artikelnummer: ARG41799.100
Protein function: Polyamine deacetylase (PDAC), which acts preferentially on N(8)-acetylspermidine, and also on acetylcadaverine and acetylputrescine (PubMed:28516954). Exhibits attenuated catalytic activity toward N(1),N(8)-diacetylspermidine and very low activity, if any, toward N(1)-acetylspermidine...
| Schlagworte: | Anti-HD10, Anti-HDAC10, Anti-Histone deacetylase 10, Anti-Polyamine deacetylase HDAC10 |
| Anwendung: | ICC, IF, IP, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
658,00 €
Anti-HDAC10
Artikelnummer: ATA-HPA056514.100
Protein function: Polyamine deacetylase (PDAC), which acts preferentially on N(8)-acetylspermidine, and also on acetylcadaverine and acetylputrescine (PubMed:28516954). Exhibits attenuated catalytic activity toward N(1),N(8)-diacetylspermidine and very low activity, if any, toward N(1)-acetylspermidine...
| Schlagworte: | Anti-HD10, Anti-HDAC10, Anti-Histone deacetylase 10, Anti-Polyamine deacetylase HDAC10 |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 358,00 €
HDAC10 (human), recombinant protein
Artikelnummer: ABS-PP-4542.100
| Schlagworte: | Polyamine deacetylase HDAC10, Histone deacetylase 10, HD10, Recombinant Human HDAC10 Protein |
| MW: | 62 kD |
ab 90,00 €
Anti-HDAC10 Recombinant
Artikelnummer: ABS-RC-6927.100
Protein function: Polyamine deacetylase (PDAC), which acts preferentially on N(8)-acetylspermidine, and also on acetylcadaverine and acetylputrescine (PubMed:28516954). Exhibits attenuated catalytic activity toward N(1),N(8)-diacetylspermidine and very low activity, if any, toward N(1)-acetylspermidine...
| Schlagworte: | Anti-Polyamine deacetylase HDAC10, Anti-Histone deacetylase 10, Anti-HD10, Recombinant HDAC10 Antibody |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 206,00 €
HDAC10 PrEST Antigen
Artikelnummer: ATA-APrEST96139.100
PrEST Antigen HDAC10, Gene description: histone deacetylase 10, Alternative Gene Names: DKFZP761B039, Antigen sequence: LTTPDITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIAATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALSMFHVS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Schlagworte: | HD10, HDAC10, Histone deacetylase 10, Polyamine deacetylase HDAC10 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €