- Suchergebnis für Q969S8
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q969S8" wurden 29 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA019662.100
Polyclonal Antibody against Human HDAC10, Gene description: histone deacetylase 10, Alternative Gene Names: DKFZP761B039, Validated applications: ICC, WB, Uniprot ID: Q969S8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Polyamine deacetylase (PDAC),...
Schlagworte: | Anti-HD10, Anti-HDAC10, Anti-Histone deacetylase 10, Anti-Polyamine deacetylase HDAC10 |
Anwendung: | WB, ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
477,00 €
Artikelnummer: Cay42085-50
Histone deacetylase 10 (HDAC10) is a zinc-dependent metalloenzyme and class IIb HDAC. It is composed of an N-terminal catalytic domain and a C-terminal leucine-rich domain. HDAC10 is ubiquitously expressed and shuttles between the cytoplasm and nucleus. It acts as a transcriptional corepressor and deacetylates...
Schlagworte: | HD10, HD10, HDAC10, Histone deacetylase 10, Histone deacetylase 10, Polyamine deacetylase HDAC10, Polyamine deacetylase... |
Exprimiert in: | Insect cells |
Ursprungsart: | human |
561,00 €
Artikelnummer: CSB-EP010236HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-669aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MGTALVYHED MTATRLLWDD PECEIERPER LTAALDRLRQ RGLEQRCLRL SAREASEEEL GLVHSPEYVS LVRETQVLGK EELQALSGQF DAIYFHPSTF HCARLAAGAG LQLVDAVLTG AVQNGLALVR...
Schlagworte: | HD10, HDAC10, Histone deacetylase 10, Polyamine deacetylase HDAC10, Recombinant Human Polyamine deacetylase HDAC10 (HDAC10) |
Anwendung: | Activity not tested |
Exprimiert in: | E.coli |
Ursprungsart: | human |
MW: | 75.5 kD |
ab 247,00 €
Artikelnummer: CSB-PA002914.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Schlagworte: | Anti-HD10, Anti-HDAC10, Anti-Histone deacetylase 10, Anti-Polyamine deacetylase HDAC10, DKFZP761B039 antibody, HD 10... |
Anwendung: | ELISA, WB, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat, monkey |
ab 126,00 €
Artikelnummer: CSB-PA249520.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Schlagworte: | Anti-HD10, Anti-HDAC10, Anti-Histone deacetylase 10, Anti-Polyamine deacetylase HDAC10, DKFZP761B039 antibody, HD 10... |
Anwendung: | ELISA, WB, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
283,00 €
Artikelnummer: BPS-50060
Active human HDAC10 (a.a. 2-631) (GenBank Accession No. NM_032019) with N-terminal FLAG-tag, MW= 67 kDa, expressed in Sf9 cells via a baculovirus expression system
Schlagworte: | HD10, HDAC10, Histone deacetylase 10, Polyamine deacetylase HDAC10, |
Anwendung: | Enzyme kinetics, inhibitor screening, profiling |
MW: | 67 kD |
618,00 €
Artikelnummer: 600-401-J75
Anti-HDAC10 was affinity purified from monospecific antiserum by immunoaffinity chromatography. A BLAST analysis was used to suggest cross-reactivity with human based on 100% sequence homology. Cross-reactivity with HDAC10 from other sources has not been determined. HDAC10 is located in the nucleus and cytoplasm,...
Schlagworte: | Anti-HD10, Anti-HDAC10, EC=3.5.1.98, Anti-Histone deacetylase 10 |
Anwendung: | ELISA, IHC, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
719,00 €
Artikelnummer: ARG41799.100
Protein function: Polyamine deacetylase (PDAC), which acts preferentially on N(8)-acetylspermidine, and also on acetylcadaverine and acetylputrescine (PubMed:28516954). Exhibits attenuated catalytic activity toward N(1),N(8)-diacetylspermidine and very low activity, if any, toward N(1)-acetylspermidine...
Schlagworte: | Anti-HD10, Anti-HDAC10, Anti-Histone deacetylase 10, Anti-Polyamine deacetylase HDAC10 |
Anwendung: | ICC, IF, IP, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
658,00 €
Artikelnummer: ATA-HPA056514.100
Protein function: Polyamine deacetylase (PDAC), which acts preferentially on N(8)-acetylspermidine, and also on acetylcadaverine and acetylputrescine (PubMed:28516954). Exhibits attenuated catalytic activity toward N(1),N(8)-diacetylspermidine and very low activity, if any, toward N(1)-acetylspermidine...
Schlagworte: | Anti-HD10, Anti-HDAC10, Anti-Histone deacetylase 10, Anti-Polyamine deacetylase HDAC10 |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 358,00 €

Artikelnummer: ABS-PP-4542.100
Schlagworte: | Polyamine deacetylase HDAC10, Histone deacetylase 10, HD10, Recombinant Human HDAC10 Protein |
MW: | 62 kD |
ab 90,00 €

Artikelnummer: ABS-RC-6927.100
Protein function: Polyamine deacetylase (PDAC), which acts preferentially on N(8)-acetylspermidine, and also on acetylcadaverine and acetylputrescine (PubMed:28516954). Exhibits attenuated catalytic activity toward N(1),N(8)-diacetylspermidine and very low activity, if any, toward N(1)-acetylspermidine...
Schlagworte: | Anti-Polyamine deacetylase HDAC10, Anti-Histone deacetylase 10, Anti-HD10, Recombinant HDAC10 Antibody |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 206,00 €

Artikelnummer: ATA-APrEST96139.100
PrEST Antigen HDAC10, Gene description: histone deacetylase 10, Alternative Gene Names: DKFZP761B039, Antigen sequence: LTTPDITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIAATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALSMFHVS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Schlagworte: | HD10, HDAC10, Histone deacetylase 10, Polyamine deacetylase HDAC10 |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €