Zu "Q04745" wurden 18 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
IL-4, Swine
Artikelnummer: CR-C03004-100UG
Sequence: MHKCDITLQE IIKTLNILTA RKNSCMELPV TDVFAAPENT TEKETFCRAS TVLRHIYRHH TCMKSLLSGL DRNLSSMANM TCSVHEAKKS FLERLKTIMK with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: Participates in at least several B-cell activation processes as well...
| Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
ab 120,00 €
Pig IL4 (Interleukin 4) ELISA Kit
Artikelnummer: ELK-ELK5717.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig IL4. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig IL4. Next, Avidin...
| Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
ab 470,00 €
Porcine IL4 ELISA Kit
Artikelnummer: ARG81290.96
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
| Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
824,00 €
IL-4 (pig) ELISA kit
Artikelnummer: BR-A05420.96
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
| Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
553,00 €
Porcine IL4 ELISA Kit
Artikelnummer: G-PRFI00098.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
641,00 €
Interleukin-4 (IL-4) (swine) Do-It-Yourself ELISA
Artikelnummer: DIY0726S-003
The swine IL-4 Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a swine IL-4 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for...
| Schlagworte: | IL-4, B-cell stimulatory factor 1, BSF-1, Lympphocyte stimulatory factor 1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
ab 1.056,00 €
Anti-Interleukin-4 (IL-4) (swine)
Artikelnummer: PB0475S-100
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
| Schlagworte: | Anti-IL4, Anti-IL-4, Anti-BSF-1, Anti-Interleukin-4, Anti-B-cell stimulatory factor 1, Anti-Lymphocyte stimulatory factor 1 |
| Anwendung: | ELISA |
| Wirt: | Goat |
| Spezies-Reaktivität: | swine, bovine, dolphin, feline |
521,00 €
Pig IL4 recombinant protein (Active)
Artikelnummer: ARG70204.100
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
| Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
| Anwendung: | SDS-PAGE, Cell culture |
| Ursprungsart: | swine |
ab 336,00 €
Pig interleukin 4, IL-4 ELISA Kit
Artikelnummer: CSB-E06785p.48
Sample Types: serum, plasma, cell culture supernates, tissue homogenates Detection Range: 6.25 pg/mL-400 pg/mL Sensitivity: 1.56 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Participates in at least several B-cell...
| Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | swine |
ab 435,00 €
Swine IL-4 Recombinant Protein (N-His) (active)
Artikelnummer: G-RPES6847.5
Protein function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the...
| Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
| Exprimiert in: | E.coli |
331,00 €
Porcine IL-4(Interleukin 4) ELISA Kit
Artikelnummer: E-EL-P3006.24
Colormetric. Detection Range: 1.56-100 pg/mL. Sensitivity: 0.89 pg/mL. Recovery rate: 80%-120%. Precision: Both intra-CV and inter-CV are < 10%.
| Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
ab 119,00 €
IL-4 protein(N-His)(active) (recombinant swine)
Artikelnummer: E-PKSS000004.5
Activity: Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <0.6 ng/mL. Sequence: MGLTSQLIPTLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC. Fusion tag: N-His Endotoxin: Please contact us for more...
| Schlagworte: | IL4, IL-4, BSF-1, Interleukin-4, B-cell stimulatory factor 1, Lymphocyte stimulatory factor 1, Recombinant Swine IL-4... |
| Anwendung: | Active, cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 15.85 kD |
234,00 €