- Suchergebnis für Q02153
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q02153" wurden 18 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA077706.100
Polyclonal Antibody against Human GUCY1B1, Gene description: guanylate cyclase 1 soluble subunit beta 1, Alternative Gene Names: GC-S-beta-1, GC-SB3, GUC1B3, GUCY1B3, Validated applications: ICC, Uniprot ID: Q02153, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
Schlagworte: | Anti-GUC1B3, Anti-GCS-beta-3, Anti-GCS-beta-1, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
477,00 €
Artikelnummer: CSB-PA002672.50
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Schlagworte: | Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
Anwendung: | ELISA, WB, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
126,00 €
Artikelnummer: CSB-PA214476.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Schlagworte: | Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
Anwendung: | ELISA, WB, IHC, IF |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
283,00 €
Artikelnummer: ARG59608.100
Protein function: Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP. [The UniProt Consortium]
Schlagworte: | Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | mouse, rat |
658,00 €
Artikelnummer: ATA-HPA020870.100
Protein function: Mediates responses to nitric oxide (NO) by catalyzing the biosynthesis of the signaling molecule cGMP. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 100% and to rat: 100%
Schlagworte: | Anti-GUC1B3, Anti-GCS-beta-3, Anti-GCS-beta-1, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
Anwendung: | IHC, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 320,00 €
Artikelnummer: ELK-ELK4914.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human GUCY1b3. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human GUCY1b3....
Schlagworte: | GUC1B3, GCS-beta-3, GCS-beta-1, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit beta-3,... |
Anwendung: | ELISA |
Spezies-Reaktivität: | human |
ab 374,00 €

Artikelnummer: ABS-PP-4473.100
Schlagworte: | Guanylate cyclase soluble subunit beta-1, GCS-beta-1, Guanylate cyclase soluble subunit beta-3, GCS-beta-3, Soluble... |
MW: | 24 kD |
ab 90,00 €

Artikelnummer: ATA-APrEST95569.100
PrEST Antigen GUCY1B1, Gene description: guanylate cyclase 1 soluble subunit beta 1, Alternative Gene Names: GC-S-beta-1, GC-SB3, GUC1B3, GUCY1B3, Antigen sequence: ISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDL, Storage: Upon delivery...
Schlagworte: | GUC1B3, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit beta-1,... |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €

Artikelnummer: CSB-PA010052GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: GUCY1B1. Antigen Species: Human
Schlagworte: | Anti-GUC1B3, Anti-GCS-beta-1, Anti-GCS-beta-3, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase... |
Anwendung: | ELISA, WB, IF |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
552,00 €

Artikelnummer: VHPS-3930
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | GUC1B3, GUCY1B3, EC=4.6.1.2, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble... |
Anwendung: | RNA quantification |
44,00 €

Artikelnummer: G9804-50B.200
Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha and a beta subunit, catalyzes the conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide and nitrovasodilator drugs. Applications: Suitable for use in ELISA and Western Blot. Other...
Schlagworte: | EC=4.6.1.2, Anti-Soluble guanylate cyclase small subunit, Anti-Guanylate cyclase soluble subunit beta-3, Anti-Guanylate... |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
767,00 €

Artikelnummer: 152637.96
Guanylate Cyclase 1 Beta 3 (GUCY1b3) BioAssay(TM) ELISA Kit (Human) is a Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Guanylate Cyclase 1 Beta 3 (GUCY1b3). Standards or samples are then added to the appropriate microtiter plate wells with a...
Schlagworte: | GUC1B3, GUCY1B3, GCS-beta-1, GCS-beta-3, Soluble guanylate cyclase small subunit, Guanylate cyclase soluble subunit... |
Anwendung: | ELISA |
Spezies-Reaktivität: | human |
1.022,00 €