Zu "P48454" wurden 19 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-PPP3CC
Artikelnummer: ATA-HPA074370.100
Polyclonal Antibody against Human PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Validated applications: ICC, Uniprot ID: P48454, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Schlagworte: | Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
Serine/threonine-protein phosphatase 2B catalytic subunit...
Artikelnummer: CSB-EP018574HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 2-512aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: SGRRFHLSTT DRVIKAVPFP PTQRLTFKEV FENGKPKVDV LKNHLVKEGR LEEEVALKII NDGAAILRQE KTMIEVDAPI TVCGDIHGQF FDLMKLFEVG GSPSNTRYLF LGDYVDRGYF SIECVLYLWS LKINHPKTLF...
| Schlagworte: | PPP3CC, CALNA3, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 62 kD |
ab 219,00 €
Anti-PPP3CC
Artikelnummer: NSJ-F40087-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation...
| Schlagworte: | Anti-CALNA3, Anti-PPP3CC, EC=3.1.3.16, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic... |
| Anwendung: | WB, IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 350,00 €
Anti-PPP3CC
Artikelnummer: NSJ-F40178-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation...
| Schlagworte: | Anti-CALNA3, Anti-PPP3CC, EC=3.1.3.16, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic... |
| Anwendung: | IHC, WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 350,00 €
Anti-PPP3CC
Artikelnummer: ATA-HPA023396.100
Protein function: Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals. Dephosphorylates and activates transcription factor NFATC1. Dephosphorylates and inactivates transcription factor ELK1. Dephosphorylates DARPP32....
| Schlagworte: | Anti-CALNA3, Anti-PPP3CC, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
| Anwendung: | ICC, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 239,00 €
PPP3CC PrEST Antigen
Artikelnummer: ATA-APrEST95711.100
PrEST Antigen PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Antigen sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Calcium-dependent,...
| Schlagworte: | PPP3CC, CALNA3, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €
Anti-PPP3CC
Artikelnummer: CSB-PA018574GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
| Schlagworte: | Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
Anti-PPP3CC
Artikelnummer: CSB-PA018574ESR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
| Schlagworte: | Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat |
ab 167,00 €
Anti-PPP3CC
Artikelnummer: CSB-PA018574ESR1HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
| Schlagworte: | Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, rat |
ab 167,00 €
PPP3CC (Vector Vector will be determined during the...
Artikelnummer: CSB-CL018574HU.10
Length: 1539 Sequence: atgtccggga ggcgcttcca cctctccacc accgaccgcg tcatcaaagc tgtccccttt cctccaaccc aacggcttac tttcaaggaa gtatttgaga atgggaaacc taaagttgat gttttaaaaa accatttggt aaaggaagga cgactggaag aggaagtagc cttaaagata atcaatgatg gggctgccat cctgaggcaa gagaagacta tgatagaagt agatgctcca atcacagtat gtggtgatat...
| Schlagworte: | CALNA3, PPP3CC, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
357,00 €
Human PPP3CC ELISA Kit
Artikelnummer: G-AEFI00086.96
ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 0.156-10µg/mL. Sensitivity: 0.094µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the...
| Schlagworte: | CALNA3, PPP3CC, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent... |
| Anwendung: | Sandwich ELISA, Double Antibody |
| Spezies-Reaktivität: | human |
641,00 €
PPP3CC, Human protein phosphatase 3 (formerly 2B),...
Artikelnummer: VHPS-7178
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | CALNA3, PPP3CC, EC=3.1.3.16, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit,... |
| Anwendung: | RNA quantification |
44,00 €