Zu "P48454" wurden 19 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-PPP3CC
Anti-PPP3CC

Artikelnummer: ATA-HPA074370.100

Polyclonal Antibody against Human PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Validated applications: ICC, Uniprot ID: P48454, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
Schlagworte: Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,...
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
477,00 €
Bewerten
Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform (PPP3CC), partial, human, re
Serine/threonine-protein phosphatase 2B catalytic subunit...

Artikelnummer: CSB-EP018574HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 2-512aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: SGRRFHLSTT DRVIKAVPFP PTQRLTFKEV FENGKPKVDV LKNHLVKEGR LEEEVALKII NDGAAILRQE KTMIEVDAPI TVCGDIHGQF FDLMKLFEVG GSPSNTRYLF LGDYVDRGYF SIECVLYLWS LKINHPKTLF...
Schlagworte: PPP3CC, CALNA3, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent...
Anwendung: Activity not tested
Exprimiert in: E.coli
Ursprungsart: human
MW: 62 kD
ab 219,00 €
Bewerten
Anti-PPP3CC
Anti-PPP3CC

Artikelnummer: NSJ-F40087-0.08ML

In 1X PBS, pH 7.4, with 0.09% sodium azide. Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation...
Schlagworte: Anti-CALNA3, Anti-PPP3CC, EC=3.1.3.16, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic...
Anwendung: WB, IHC, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 350,00 €
Bewerten
Anti-PPP3CC
Anti-PPP3CC

Artikelnummer: NSJ-F40178-0.08ML

In 1X PBS, pH 7.4, with 0.09% sodium azide. Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation...
Schlagworte: Anti-CALNA3, Anti-PPP3CC, EC=3.1.3.16, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic...
Anwendung: IHC, WB, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 350,00 €
Bewerten
Anti-PPP3CC
Anti-PPP3CC

Artikelnummer: ATA-HPA023396.100

Protein function: Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals. Dephosphorylates and activates transcription factor NFATC1. Dephosphorylates and inactivates transcription factor ELK1. Dephosphorylates DARPP32....
Schlagworte: Anti-CALNA3, Anti-PPP3CC, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,...
Anwendung: ICC, IHC, WB
Wirt: Rabbit
Spezies-Reaktivität: human
ab 239,00 €
Bewerten
PPP3CC PrEST Antigen
PPP3CC PrEST Antigen

Artikelnummer: ATA-APrEST95711.100

PrEST Antigen PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Antigen sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Calcium-dependent,...
Schlagworte: PPP3CC, CALNA3, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent...
Exprimiert in: E.coli
Ursprungsart: human
265,00 €
Bewerten
Anti-PPP3CC
Anti-PPP3CC

Artikelnummer: CSB-PA018574GA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
Schlagworte: Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,...
Anwendung: ELISA, WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
552,00 €
Bewerten
Anti-PPP3CC
Anti-PPP3CC

Artikelnummer: CSB-PA018574ESR2HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
Schlagworte: Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,...
Anwendung: ELISA, WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, rat
ab 167,00 €
Bewerten
Anti-PPP3CC
Anti-PPP3CC

Artikelnummer: CSB-PA018574ESR1HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PPP3CC. Antigen Species: Human
Schlagworte: Anti-PPP3CC, Anti-CALNA3, Anti-CAM-PRP catalytic subunit, Anti-Calcineurin, testis-specific catalytic subunit,...
Anwendung: ELISA, WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, rat
ab 167,00 €
Bewerten
PPP3CC (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
PPP3CC (Vector Vector will be determined during the...

Artikelnummer: CSB-CL018574HU.10

Length: 1539 Sequence: atgtccggga ggcgcttcca cctctccacc accgaccgcg tcatcaaagc tgtccccttt cctccaaccc aacggcttac tttcaaggaa gtatttgaga atgggaaacc taaagttgat gttttaaaaa accatttggt aaaggaagga cgactggaag aggaagtagc cttaaagata atcaatgatg gggctgccat cctgaggcaa gagaagacta tgatagaagt agatgctcca atcacagtat gtggtgatat...
Schlagworte: CALNA3, PPP3CC, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent...
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
357,00 €
Bewerten
Human PPP3CC ELISA Kit
Human PPP3CC ELISA Kit

Artikelnummer: G-AEFI00086.96

ELISA Type: Sandwich ELISA, Double Antibody. Detection Range: 0.156-10µg/mL. Sensitivity: 0.094µg/mL. Sample Types: Serum, Plasma, Cell Culture Supernatant, cell or tissue lysate, Other liquid samples. Protein function: Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the...
Schlagworte: CALNA3, PPP3CC, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent...
Anwendung: Sandwich ELISA, Double Antibody
Spezies-Reaktivität: human
641,00 €
Bewerten
PPP3CC, Human protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform, Real Time PCR P
PPP3CC, Human protein phosphatase 3 (formerly 2B),...

Artikelnummer: VHPS-7178

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: CALNA3, PPP3CC, EC=3.1.3.16, CAM-PRP catalytic subunit, Calcineurin, testis-specific catalytic subunit,...
Anwendung: RNA quantification
44,00 €
Bewerten
1 von 2 Seiten