- Suchergebnis für P29400
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P29400" wurden 12 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: CSB-PA163254.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Schlagworte: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain, CO4A5_HUMAN antibody, COL4A5 antibody, Collagen alpha-5(IV) chain antibody,... |
Anwendung: | ELISA, IHC, IF |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
275,00 €
Artikelnummer: ELK-ELK5603.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human COL4a5. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human COL4a5....
Schlagworte: | COL4A5, Collagen alpha-5(IV) chain |
Anwendung: | ELISA |
Spezies-Reaktivität: | human |
ab 365,00 €
-30 %
Rabattaktion
Artikelnummer: ARG66926.100
Protein function: Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. [The UniProt Consortium]
Schlagworte: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain, Anti-Collagen alpha-5(IV) chain |
Anwendung: | IHC (paraffin) |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
408,00 €
ab 285,60 €
Artikelnummer: CSB-PA007072.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Schlagworte: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain, CO4A5_HUMAN antibody, COL4A5 antibody, Collagen alpha-5(IV) chain antibody,... |
Anwendung: | ELISA, IHC, IF |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
ab 106,00 €
Artikelnummer: G-CAB16360.100
Protein function: Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. [The UniProt Consortium]
Schlagworte: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain, COL4A5 Polyclonal Antibody |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 138,00 €
Artikelnummer: ELK-ES4740.100
This gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes. Mutations in this gene are associated with X-linked Alport syndrome, also known as hereditary nephritis. Like the other members of the type IV collagen gene family, this gene is organized in a...
Schlagworte: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain, COL4A5 rabbit pAb |
Anwendung: | IHC, IF, WB, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
ab 169,00 €
Artikelnummer: VHPS-2112
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | COL4A5, Collagen alpha-5(IV) chain |
Anwendung: | RNA quantification |
43,00 €
Artikelnummer: 034094.200
Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and...
Schlagworte: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
728,00 €
Artikelnummer: 154093.10
Source:, Recombinant Human from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P29400, Fragment: Gly1461~Thr1685 (Accession No: P29400), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-GFLITRHSQT TDAPQCPQGT LQVYEGFSLL YVQGNKRAHG QDLGTAGSCL RRFSTMPFMF...
ab 361,00 €
Artikelnummer: 517108.96
This sandwich ELISA kit is used for in vitro quantitative measurement of COL4a5 in human serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. Sensitivity: 1.12ng/ml, Range: 3.12-200ng/ml, Specificity: This assay has high sensitivity and excellent specificity for...
Schlagworte: | COL4A5, Collagen alpha-5(IV) chain |
Anwendung: | ELISA |
Spezies-Reaktivität: | human |
1.037,00 €
Artikelnummer: G-CAB9809.20
Protein function: Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. [The UniProt Consortium]
Schlagworte: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
149,00 €
Artikelnummer: ABD-8C12199.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-Collagen IV alpha5 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750,...
Schlagworte: | Anti-COL4A5, Anti-Collagen alpha-5(IV) chain, Collagen IV alpha5 Antibody |
Anwendung: | IHC, IF, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
601,00 €