Zu "P26894" wurden 17 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
IL-8, Swine
Artikelnummer: CR-C03006-100UG
Sequence: MARVSAELRC QCINTHSTPF HPKFIKELRV IESGPHCENS EIIVKLVNGK EVCLDPKEKW VQKVVQIFLK with polyhistidine tag at the C-terminus Endotoxin level: <0.1 EU per 1 µg of the protein by the LAL method. Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It...
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | Cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
ab 120,00 €
Pig IL8 (Interleukin 8) ELISA Kit
Artikelnummer: ELK-ELK1219.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Pig IL8. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Pig IL8. Next, Avidin...
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
ab 422,00 €
Interleukin-8 (IL-8) (swine) Do-It-Yourself ELISA
Artikelnummer: DIY0728S-003
The swine IL-8 Do-It-Yourself ELISA contains capture antibody, standard, and detection antibody for development of a swine IL-8 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for...
| Schlagworte: | IL8, IL-8, CXCL8, Interleukin-8, C-X-C motif chemokine 8 |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
ab 1.056,00 €
IL-8 (pig) ELISA kit
Artikelnummer: BR-A05421.96
Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
553,00 €
Anti-Interleukin-8 (IL-8) (swine)
Artikelnummer: PB0143S-100
Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]
| Schlagworte: | Anti-IL-8, Anti-IL8, Anti-C-X-C motif chemokine 8, Anti-CXCL8 |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | swine, bovine, dog, feline, rabbit |
521,00 €
Interleukin-8 (1-72) (CXCL8), porcine recombinant...
Artikelnummer: 94878.1
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. (www.uniprot.org) Produced in E.coli as a single, non-glycosylated, polypeptide chain...
| Schlagworte: | IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating... |
| Anwendung: | Chemoattract. |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 8291 D |
ab 94,00 €
Porcine IL-8(Interleukin-8) ELISA Kit
Artikelnummer: G-PRFI00169.96
Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. [The UniProt Consortium]
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
694,00 €
NEU
Pig interleukin 8, IL-8 ELISA Kit
Artikelnummer: CSB-E06787p.48
Sample Types: serum, plasma, cell culture supernates, tissue homogenates Detection Range: 125 pg/mL-8000 pg/mL Sensitivity: 31.25 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: IL-8 is a chemotactic factor that attracts...
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | ELISA, Sandwich ELISA |
| Spezies-Reaktivität: | swine |
ab 435,00 €
Swine IL-8 Recombinant Protein (N-His) (active)
Artikelnummer: G-RPES6849.5
Protein function: Chemotactic factor that mediates inflammatory response by attracting neutrophils, basophils, and T-cells to clear pathogens and protect the host from infection. Also plays an important role in neutrophil activation. Released in response to an inflammatory stimulus, exerts its effect by binding to...
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Exprimiert in: | E.coli |
331,00 €
Porcine IL-8(Interleukin 8) ELISA Kit
Artikelnummer: E-EL-P3004.24
Colormetric. Detection Range: 1.56-100 pg/mL. Sensitivity: 0.83 pg/mL. Recovery rate: 80%-120%. Precision: Both intra-CV and inter-CV are < 10%.
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | swine |
ab 119,00 €
IL-8 protein(N-His)(active) (recombinant swine)
Artikelnummer: E-PKSS000006.5
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <5 ng/mL. Sequence: MTSKLAVAFLAVFLLSAALCEAAVLARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ. Fusion tag: N-His Endotoxin: Please contact us for more information....
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | Active, cell culture |
| Exprimiert in: | E.coli |
| Ursprungsart: | swine |
| MW: | 12.46 kD |
234,00 €
IL-8 (CXCL8), swine recombinant (rpoIL-8)
Artikelnummer: RP0109S-005
Produced in Yeast. Amino acid sequence: ARVSAELRCQ CINTHSTPFH PKFIKELRVI ESGPHCENSE IIVKLVNGKE VCLDPKEKWV QKVVQIFLKR TEKQQQQQ (78). Protein function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from...
| Schlagworte: | IL8, IL-8, CXCL8, AMCF-I, Interleukin-8, C-X-C motif chemokine 8, Chemokine (C-X-C motif) ligand 8, Alveolar macrophage... |
| Anwendung: | Bioassays |
| Exprimiert in: | Yeast |
| Ursprungsart: | swine |
| MW: | 9,1 kD |
ab 206,00 €