Zu "P01275" wurden 107 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
GLP-1 (7-13) (human, mouse, rat, bovine)...
Artikelnummer: Cay41255-1
Glucagon-like peptide 1 (GLP-1) (7-13) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460, Cay-24755). It contains several amino acids involved in binding and activation of the GLP-1 receptor (GLP-1R).Formal Name:...
| Schlagworte: | Glucagon-like Peptide 1 (7-13), His-Ala-Glu-Gly-Thr-Phe-Thr-OH,... |
| Anwendung: | GLP-1 peptide fragment |
| MW: | 761.8 D |
ab 74,00 €
GLP-1 (7-15) (human, mouse, rat, porcine, bovine, ovine)...
Artikelnummer: Cay41256-1
Glucagon-like peptide 1 (GLP-1) (7-15) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460). GLP-1 (7-15) is formed by cleavage of the peptide bond between Asp15 and Val16 in GLP-1 by neprilysin.Formal Name:...
| Schlagworte: | Glucagon-like Peptide 1 (7-15),... |
| Anwendung: | GLP-1 peptide fragment |
| MW: | 964 D |
ab 36,00 €
GLP-1 (7-17) (human, mouse, rat, porcine, bovine, ovine)...
Artikelnummer: Cay41257-1
Glucagon-like peptide 1 (GLP-1) (7-17) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460).Formal Name: L-histidyl-L-alanyl-L-alpha-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-serine, trifluoroacetate salt. Synonyms: Glucagon-like Peptide 1 (7-17)....
| Schlagworte: | Glucagon-like Peptide 1 (7-17),... |
| Anwendung: | GLP-1 peptide fragment |
| MW: | 1150.2 D |
ab 35,00 €
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)
Artikelnummer: Cay41332-10
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a derivative of the endogenous incretin hormone glucagon-like peptide 1 (GLP-1, Cay-24460).Formal Name:...
| Schlagworte: | (S)-N1-((S)-6-amino-1-(((S)-3-hydroxy-1-(((3S,7S)-8-(((S)-3-hydroxy-1-(((2S,3R)-3-hydroxy-1-oxo-1-(((S)-1-oxo-3-phenylprop... |
| Anwendung: | GLP-1 derivative |
| MW: | 3692.1 D |
ab 171,00 €
GCG Protein, Human, Recombinant (His)
Artikelnummer: TGM-TMPJ-00742-10ug
Description: Glucagon is a secreted protein and belongs to the glucagon family. Glucagon can be cleved into 8 chains, playing an important role in initiating and maintaining hyperglycemic conditions in diabetes. Glucagon can regulates blood glucose by decreasing glycolysis and increasing gluconeogenesis. In...
| Schlagworte: | OXY, Incretin Hormone, Oxyntomodulin, Glicentin-Related Polypeptide, Glucagon-Like Peptide 2, Glucagon, GCG, GLP-1, GLP-2,... |
| MW: | 19 kD |
ab 184,00 €
Pro-glucagon (GCG), partial, human, recombinant
Artikelnummer: CSB-YP009315HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 53-89aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: HSQGTFTSDY SKYLDSRRAQ DFVQWLMNTK RNRNNIA. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological Activity: n/a. Form: Liquid or...
| Schlagworte: | Recombinant Human Pro-glucagon (GCG), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | human |
| MW: | 6.4 kD |
ab 292,00 €
Pro-glucagon (GCG), partial, human, recombinant
Artikelnummer: CSB-EP009315HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 53-89aa. Protein Length: Partial. Tag Info: N-terminal GST-tagged. Target Protein Sequence: HSQGTFTSDY SKYLDSRRAQ DFVQWLMNTK RNRNNIA. Purity: Greater than 85% as determined by SDS-PAGE. Endotoxin: Not test. Biological Activity: n/a. Form: Liquid or...
| Schlagworte: | Recombinant Human Pro-glucagon (GCG), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 30.4 kD |
ab 247,00 €
Pro-glucagon (GCG), partial, human, recombinant
Artikelnummer: CSB-EP009315HUc0.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 53-89aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: HSQGTFTSDY SKYLDSRRAQ DFVQWLMNTK RNRNNIA. Purity: Greater than 85% as determined by SDS-PAGE. Endotoxin: Not test. Biological Activity: n/a. Form:...
| Schlagworte: | Recombinant Human Pro-glucagon (GCG), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 34.4 kD |
ab 247,00 €
Anti-GCG
Artikelnummer: CSB-PA002654.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Schlagworte: | GCG antibody, Glicentin related polypeptide antibody, glicentin-related polypeptide antibody, GLP-1 antibody, GLP-1(7-36)... |
| Anwendung: | ELISA, WB, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat, monkey |
ab 126,00 €
Anti-GCG
Artikelnummer: CSB-PA132302.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: GCG. Antigen Species: Human
| Schlagworte: | GCG antibody, Glicentin related polypeptide antibody, glicentin-related polypeptide antibody, GLP-1 antibody, GLP-1(7-36)... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 167,00 €
Anti-GCG
Artikelnummer: CSB-PA135172.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: GCG. Antigen Species: Human
| Schlagworte: | GCG antibody, Glicentin related polypeptide antibody, glicentin-related polypeptide antibody, GLP-1 antibody, GLP-1(7-36)... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 167,00 €
Anti-GCG Monoclonal
Artikelnummer: CSB-MA935920.100
Host Species: Mouse. Isotype: IgG2b, Kappa. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from mouse ascites by affinity-chromatography using specific...
| Schlagworte: | Glicentin, Glicentin-related polypeptide, Oxyntomodulin, Glucagon-like peptide 1(GLP-1), Glucagon-like peptide 1(7-37),... |
| Anwendung: | ELISA, IHC |
| Wirt: | Mouse |
| Spezies-Reaktivität: | human |
ab 167,00 €