Zu "O15554" wurden 26 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-KCNN4
Artikelnummer: ATA-HPA013367.100
Polyclonal Antibody against Human KCNN4, Gene description: potassium calcium-activated channel subfamily N member 4, Alternative Gene Names: hIKCa1, hKCa4, hSK4, IK, KCa3.1, Validated applications: ICC, Uniprot ID: O15554, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
| Schlagworte: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-IKCa1, Anti-KCNN4, Anti-SKCa4, Anti-KCa3.1, Anti-SKCa 4, Anti-Putative Gardos channel,... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
450,00 €
Anti-KCNN4
Artikelnummer: CSB-PA484256.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: KCNN4. Antigen Species: Human
| Schlagworte: | Anti-SK4, Anti-IK1, Anti-KCa4, Anti-IKCa1, Anti-KCNN4, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-KCNN4
Artikelnummer: CSB-PA980762.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: KCNN4. Antigen Species: Human
| Schlagworte: | Anti-SK4, Anti-IK1, Anti-KCa4, Anti-IKCa1, Anti-KCNN4, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 167,00 €
Intermediate conductance calcium-activated potassium...
Artikelnummer: CSB-CF012086HU.100
Organism: Homo sapiens (Human). Source: in vitro E.coli expression system. Expression Region: 1-427aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: MGGDLVLGLG ALRRRKRLLE QEKSLAGWAL VLAGTGIGLM VLHAEMLWFG GCSWALYLFL VKCTISISTF LLLCLIVAFH AKEVQLFMTD NGLRDWRVAL TGRQAAQIVL...
| Schlagworte: | IK1, SK4, KCa4, IKCa1, SKCa4, KCNN4, KCa3.1, SKCa 4, Putative Gardos channel, Intermediate conductance calcium-activated... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli in vitro |
| Ursprungsart: | human |
| MW: | 53.7 kD |
ab 1.458,00 €
Anti-KCNN4
Artikelnummer: E-AB-13359.120
The protein encoded by this gene is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization, which promotes calcium influx. The encoded protein may be part of the predominant calcium-activated...
| Schlagworte: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 89,00 €
Anti-KCNN4
Artikelnummer: NSJ-RQ4583
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Intermediate conductance calcium-activated potassium channel protein 1 (KCNN4, Kca3.1) is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane...
| Schlagworte: | Anti-SK4, Anti-IK1, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-KCa3.1, Anti-SKCa 4, Anti-Putative Gardos channel,... |
| Anwendung: | WB, Direct ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
772,00 €
Anti-KCNN4 / KCa3.1
Artikelnummer: ARG42195.50
Protein function: Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T-cells...
| Schlagworte: | Anti-SK4, Anti-IK1, Anti-KCa4, Anti-SKCa4, Anti-IKCa1, Anti-KCNN4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
551,00 €
Anti-KCNN4
Artikelnummer: ATA-HPA053841.100
Protein function: Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T-cells...
| Schlagworte: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 320,00 €
Anti-KCNN4
Artikelnummer: ATA-HPA059622.100
Protein function: Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T-cells...
| Schlagworte: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 320,00 €
Anti-KCNN4(SK4)
Artikelnummer: ELK-EA302.50
Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Protein function: Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization...
| Schlagworte: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-SKCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
| Anwendung: | WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
173,00 €
Anti-KCNN4 / KCa3.1 / SKCa4
Artikelnummer: NSJ-RQ7087
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Intermediate conductance calcium-activated potassium channel protein 1 (KCNN4, Kca3.1) is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane...
| Schlagworte: | Anti-IK1, Anti-SK4, Anti-KCa4, Anti-KCNN4, Anti-IKCa1, Anti-SKCa4, Anti-SKCa 4, Anti-KCa3.1, Anti-Putative Gardos channel,... |
| Anwendung: | WB, Direct ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
772,00 €
KCNN4 PrEST Antigen
Artikelnummer: ATA-APrEST96183.100
PrEST Antigen KCNN4, Gene description: potassium calcium-activated channel subfamily N member 4, Alternative Gene Names: hIKCa1, hKCa4, hSK4, IK, KCa3.1, Antigen sequence: LQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQ, Storage: Upon delivery store at...
| Schlagworte: | IK1, SK4, KCa4, KCNN4, SKCa4, IKCa1, KCa3.1, SKCa 4, Putative Gardos channel, Intermediate conductance calcium-activated... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €