Zu "K11350" wurden 10 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
NI-57
Artikelnummer: Cay17662-5
The bromodomain and PHD finger-containing (BRPF) proteins are scaffolding components of chromatin-binding MOZ/MORF histone acetyltransferase complexes, which have activity as transcriptional regulators. BRPF1 (BR140 or Peregrin) is important for maintaining Hox gene expression and the development of multiple...
| Schlagworte: | 4-cyano-N-(1,2-dihydro-1,3-dimethyl-2-oxo-6-quinolinyl)-2-methoxy-benzenesulfonamide |
| Anwendung: | BRPF bromodomain inhibitor |
| CAS | 1883548-89-7 |
| MW: | 383.4 D |
ab 44,00 €
OF-1
Artikelnummer: Cay17124-25
OF-1 is a chemical probe for the bromodomains of the Bromodomain and PHD Finger-containing (BRPF) family of proteins. It binds BRPF1B, BRPF2, and BRPF3 with Kd values of 0.1, 0.5, and 2.4 µM, respectively, as determined by isothermal titration calorimetry. OF-1 increases thermal stability of full length BRPF1B at 1...
| Schlagworte: | 4-bromo-N-(2,3-dihydro-6-methoxy-1,3-dimethyl-2-oxo-1H-benzimidazol-5-yl)-2-methyl-benzenesulfonamide |
| Anwendung: | BRPF probe |
| CAS | 919973-83-4 |
| MW: | 440.3 D |
ab 67,00 €
BRPF3 (576-701), Human Recombinant Protein
Artikelnummer: BPS-31130
Human Bromodomain and PHD finger containing 3, or BRPF3, amino-acids 576 - 701 (GenBank Accession No. NM_015695) with N-terminal GST-tag, MW = 41.2 kDa, expressed in an E. coli expression system.
| Schlagworte: | Bromodomain and PHD finger-containing protein 3, |
| Anwendung: | Bromodomain binding assays, inhibitor screening, selectivity profiling |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 41.2 kD |
461,00 €
BRPF3 TR-FRET Assay Kit
Artikelnummer: BPS-32626
The BRPF3 TR-FRET Assay Kit is designed to measure the inhibition of BRPF3 binding to its substrate in a homogeneous 384 reaction format. This FRET-based assay requires no time-consuming washing steps, making it especially suitable for high throughput screening applications. The assay procedure is straightforward...
| Schlagworte: | Bromodomain and PHD finger-containing protein 3, |
| Anwendung: | Small molecular inhibitor screening, drug discovery, HTS |
| Spezies-Reaktivität: | human |
1.563,00 €
Anti-BRPF3
Artikelnummer: ATA-HPA022787.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:26620551, PubMed:26677226). Plays a role in DNA replication initiation by directing KAT7/HBO1 specificity...
| Schlagworte: | Anti-Bromodomain and PHD finger-containing protein 3 |
| Anwendung: | ICC, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 239,00 €
BRPF3 (human), recombinant protein
Artikelnummer: ABS-PP-2915.20
| Schlagworte: | Bromodomain and PHD finger-containing protein 3, Recombinant Human BRPF3 Protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 21 kD |
ab 90,00 €
BRPF3 (Vector pUC, Accession No. BC117387)
Artikelnummer: CSB-CL890928HU.10
Length: 2808 Sequence: atgaggaagc ctcgtcggaa gtcccggcag aatgccgagg gccggcgttc cccgtccccc tacagtctca agtgctcacc cacccgggag accctgacat atgcccaggc ccagcggatt gtcgaggtag acattgatgg acgcctgcat cgtatcagca tctatgaccc actcaaaatc attactgaag atgagctaac tgcccaggat atcaccgaat gcaatagtaa caaggaaaac agtgaacagc ctcagttccc...
| Schlagworte: | Bromodomain and PHD finger-containing protein 3 |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
1.018,00 €
BRPF3, Recombinant, Human, aa576-701, GST-tag...
Artikelnummer: 298384.100
Source:, Recombinant protein corresponding to a single bromodomain, aa576-701, from human Bromodomain and PHD finger containing 3, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.2kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI,...
| Schlagworte: | BRPF3, KIAA1286, Bromodomain and PHD finger-containing protein 3 |
| MW: | 41,2 |
937,00 €
BRPF3 TR-FRET, BioAssay(TM) Kit (KIAA1286)
Artikelnummer: 298383.1
Kit comes in a convenient format with purified BRPF3 protein, ligands, Tb donor, dye-labeled acceptor, assay buffer and microtiter plate to perform 384 reactions. The BRPF3 TR-FRET BioAssay(TM) Kit is designed to measure the inhibition of BRPF3 binding to its substrate in a homogeneous 384 reaction format. This...
| Schlagworte: | Bromodomain and PHD finger-containing protein 3 |
| Anwendung: | FRET, Assays |
| Spezies-Reaktivität: | human |
1.898,00 €
BRPF3 PrEST Antigen
Artikelnummer: ATA-APrEST86913.100
Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:26620551, PubMed:26677226). Plays a role in DNA replication initiation by directing KAT7/HBO1 specificity...
| Schlagworte: | Bromodomain and PHD finger-containing protein 3 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €