Zu "K05259" wurden 144 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Glucagon (hydrochloride)
Artikelnummer: Cay24204-1
Glucagon is a peptide hormone produced from proglucagon in pancreatic alpha cells that has a role in the regulation of glucose metabolism. Pulsatile application of glucagon to rat hepatocytes stimulates glucose production ex vivo. It also stimulates glucose output from perfused rat livers via increases in...
| Schlagworte: | glucagon (swine) |
| Ursprungsart: | swine |
| CAS | 19179-82-9 |
| MW: | 3482.8 D |
ab 120,00 €
GLP-1 (7-36) acid (human, mouse, rat, porcine, bovine)
Artikelnummer: Cay41250-1
Glucagon-like peptide 1 (GLP-1) (7-36) acid is a derivative of the hormone and GLP-1 receptor (GLP-1R) agonist GLP-1 (7-36) amide. It enhances insulin-induced phosphorylation of Akt in 3T3-L1 adipocytes when used at a concentration of 100 nM in the presence of a dipeptidyl peptidase 4 (DPP-4) inhibitor. GLP-1 (7-36)...
| Schlagworte: | Glucagon-like Peptide 1 (7-36) acid,... |
| Anwendung: | GLP-1 derivative |
| MW: | 3358.7 D |
ab 35,00 €
GLP-1 (7-13) (human, mouse, rat, bovine)...
Artikelnummer: Cay41255-1
Glucagon-like peptide 1 (GLP-1) (7-13) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460, Cay-24755). It contains several amino acids involved in binding and activation of the GLP-1 receptor (GLP-1R).Formal Name:...
| Schlagworte: | Glucagon-like Peptide 1 (7-13), His-Ala-Glu-Gly-Thr-Phe-Thr-OH,... |
| Anwendung: | GLP-1 peptide fragment |
| MW: | 761.8 D |
ab 74,00 €
GLP-1 (7-15) (human, mouse, rat, porcine, bovine, ovine)...
Artikelnummer: Cay41256-1
Glucagon-like peptide 1 (GLP-1) (7-15) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460). GLP-1 (7-15) is formed by cleavage of the peptide bond between Asp15 and Val16 in GLP-1 by neprilysin.Formal Name:...
| Schlagworte: | Glucagon-like Peptide 1 (7-15),... |
| Anwendung: | GLP-1 peptide fragment |
| MW: | 964 D |
ab 36,00 €
GLP-1 (7-17) (human, mouse, rat, porcine, bovine, ovine)...
Artikelnummer: Cay41257-1
Glucagon-like peptide 1 (GLP-1) (7-17) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460).Formal Name: L-histidyl-L-alanyl-L-alpha-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-serine, trifluoroacetate salt. Synonyms: Glucagon-like Peptide 1 (7-17)....
| Schlagworte: | Glucagon-like Peptide 1 (7-17),... |
| Anwendung: | GLP-1 peptide fragment |
| MW: | 1150.2 D |
ab 35,00 €
Elsiglutide (acetate)
Artikelnummer: Cay41273-1
Elsiglutide is a peptide derivative of glucagon-like peptide 2 (GLP-2). It increases jejunum and ileum crypt depth and villus height without disrupting gut microbiota diversity in rats when administered at a dose of 0.9 mg/kg four days per week. Elsiglutide decreases diarrhea severity and incidence induced by the...
| Anwendung: | Peptide, GLP-2 derivative |
| MW: | 4318 D |
ab 62,00 €
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)
Artikelnummer: Cay41332-10
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a derivative of the endogenous incretin hormone glucagon-like peptide 1 (GLP-1, Cay-24460).Formal Name:...
| Schlagworte: | (S)-N1-((S)-6-amino-1-(((S)-3-hydroxy-1-(((3S,7S)-8-(((S)-3-hydroxy-1-(((2S,3R)-3-hydroxy-1-oxo-1-(((S)-1-oxo-3-phenylprop... |
| Anwendung: | GLP-1 derivative |
| MW: | 3692.1 D |
ab 171,00 €
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)
Artikelnummer: Cay41337-1
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a peptide.Formal Name:...
| Schlagworte: | (S)-N1-((S)-6-amino-1-(((S)-3-hydroxy-1-(((3S,7S)-8-(((S)-3-hydroxy-1-(((2S,3R)-3-hydroxy-1-(((S)-1-(((2S,3R)-3-hydroxy-1-... |
| Anwendung: | Peptide, GLP-1 mimic |
| MW: | 3850.2 D |
ab 116,00 €
GCG Protein, Human, Recombinant (His)
Artikelnummer: TGM-TMPJ-00742-10ug
Description: Glucagon is a secreted protein and belongs to the glucagon family. Glucagon can be cleved into 8 chains, playing an important role in initiating and maintaining hyperglycemic conditions in diabetes. Glucagon can regulates blood glucose by decreasing glycolysis and increasing gluconeogenesis. In...
| Schlagworte: | OXY, Incretin Hormone, Oxyntomodulin, Glicentin-Related Polypeptide, Glucagon-Like Peptide 2, Glucagon, GCG, GLP-1, GLP-2,... |
| MW: | 19 kD |
ab 184,00 €
GLP-1 (28-36) amide (trifluoroacetate salt)
Artikelnummer: Cay41249-1
Glucagon-like peptide 1 (GLP-1) (28-36) amide is a peptide and an active metabolite of the endogenous GLP-1R agonist GLP-1 (7-36) amide (Cay-15069). It is formed from GLP-1 (7-36) amide by neprilysin (NEP). GLP-1 (28-36) amide (100 nM) inhibits decreases in ATP levels induced by hydrogen peroxide and increases in...
| Schlagworte: | Glucagon-like Peptide 1 (28-36) amide, Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2,... |
| Anwendung: | Peptide, active GLP-1 (7-36) amide metabolite |
| MW: | 1088.4 D |
ab 39,00 €
Pro-glucagon (GCG), partial, human, recombinant
Artikelnummer: CSB-YP009315HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 53-89aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: HSQGTFTSDY SKYLDSRRAQ DFVQWLMNTK RNRNNIA. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological Activity: n/a. Form: Liquid or...
| Schlagworte: | Recombinant Human Pro-glucagon (GCG), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | human |
| MW: | 6.4 kD |
ab 292,00 €
Glucagon (Gcg), partial, mouse, recombinant
Artikelnummer: CSB-YP009315MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 21-89aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: HALQDTEENP RSFPASQTEA HEDPDEMNED KRHSQGTFTS DYSKYLDSRR AQDFVQWLMN TKRNRNNIA. Purity: Greater than 95% as determined by SDS-PAGE. Endotoxin: n/a. Biological...
| Schlagworte: | Gcg, Recombinant Mouse Glucagon (Gcg), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | mouse |
| MW: | 9.7 kD |
ab 292,00 €