Zu "K05259" wurden 146 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Glucagon (hydrochloride)
Artikelnummer: Cay24204-1
Glucagon is a peptide hormone produced from proglucagon in pancreatic alpha cells that has a role in the regulation of glucose metabolism. Pulsatile application of glucagon to rat hepatocytes stimulates glucose production ex vivo. It also stimulates glucose output from perfused rat livers via increases in...
| Schlagworte: | glucagon (swine) |
| Ursprungsart: | swine |
| CAS | 19179-82-9 |
| MW: | 3482.8 D |
ab 119,00 €
Tirzepatide
Artikelnummer: LKT-T342710.1
Tirzepatide is a dual GLP-1/GIP receptor co-agonist. It has been shown to stimulate catabolism of branched-chain amino acids and branched-chain keto acids in thermogenic brwon adipose tissue in mice. It has demonstrated superior glycemic control compared with GLP-1R agonism and improved insulin sensitivity. SMILES:...
| Schlagworte: | LY3298176, Mounjaro |
| Anwendung: | GLP-1/GIP receptor co-agonist |
| CAS | 2023788-19-2 |
| MW: | 4813 D |
ab 229,00 €
Semaglutide
Artikelnummer: LKT-S176481.1
Semaglutide is a long-acting GLP-1 receptor agonist. Treatment of obese mice led to reduced body weight, improved oxidative stress indexes, and improved performance in water maze testing. Pretreatment of albino mice with induced ischemia and reperfusion injury with semaglutide showed modulated inflammatory response...
| Schlagworte: | NN9535, NNC 0113-0217 |
| Anwendung: | GLP-1 agonist |
| CAS | 910463-68-2 |
| MW: | 4113.64 D |
ab 99,00 €
GLP-1 (1-32) (bullfrog) (trifluoroacetate salt)
Artikelnummer: Cay40718-5
Glucagon-like peptide 1 (GLP-1) (1-32) is an endogenous incretin hormone. It increases intracellular cAMP levels using HEK293 cells expressing human GLP-1 receptor (GLP-1R, EC50 = 0.051 nM). In vivo, GLP-1 (1-32) (30 mg/kg) reduces blood glucose levels in an oral glucose tolerance test (OGTT) in fasted mice.Formal...
| Schlagworte: | Glucagon-like Peptide 1 (1-32),... |
| Anwendung: | Endogenous incretin hormone |
| MW: | 3658.1 D |
ab 35,00 €
GLP-1 (7-36) acid (human, mouse, rat, porcine, bovine)
Artikelnummer: Cay41250-1
Glucagon-like peptide 1 (GLP-1) (7-36) acid is a derivative of the hormone and GLP-1 receptor (GLP-1R) agonist GLP-1 (7-36) amide. It enhances insulin-induced phosphorylation of Akt in 3T3-L1 adipocytes when used at a concentration of 100 nM in the presence of a dipeptidyl peptidase 4 (DPP-4) inhibitor. GLP-1 (7-36)...
| Schlagworte: | Glucagon-like Peptide 1 (7-36) acid,... |
| Anwendung: | GLP-1 derivative |
| MW: | 3358.7 D |
ab 35,00 €
GLP-1 (7-13) (human, mouse, rat, bovine)...
Artikelnummer: Cay41255-1
Glucagon-like peptide 1 (GLP-1) (7-13) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460, Cay-24755). It contains several amino acids involved in binding and activation of the GLP-1 receptor (GLP-1R).Formal Name:...
| Schlagworte: | Glucagon-like Peptide 1 (7-13), His-Ala-Glu-Gly-Thr-Phe-Thr-OH,... |
| Anwendung: | GLP-1 peptide fragment |
| MW: | 761.8 D |
ab 74,00 €
GLP-1 (7-15) (human, mouse, rat, porcine, bovine, ovine)...
Artikelnummer: Cay41256-1
Glucagon-like peptide 1 (GLP-1) (7-15) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460). GLP-1 (7-15) is formed by cleavage of the peptide bond between Asp15 and Val16 in GLP-1 by neprilysin.Formal Name:...
| Schlagworte: | Glucagon-like Peptide 1 (7-15),... |
| Anwendung: | GLP-1 peptide fragment |
| MW: | 964 D |
ab 36,00 €
GLP-1 (7-17) (human, mouse, rat, porcine, bovine, ovine)...
Artikelnummer: Cay41257-1
Glucagon-like peptide 1 (GLP-1) (7-17) is a peptide fragment of the endogenous incretin hormone GLP-1 (Cay-24460).Formal Name: L-histidyl-L-alanyl-L-alpha-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-serine, trifluoroacetate salt. Synonyms: Glucagon-like Peptide 1 (7-17)....
| Schlagworte: | Glucagon-like Peptide 1 (7-17),... |
| Anwendung: | GLP-1 peptide fragment |
| MW: | 1150.2 D |
ab 35,00 €
Elsiglutide (acetate)
Artikelnummer: Cay41273-1
Elsiglutide is a peptide derivative of glucagon-like peptide 2 (GLP-2). It increases jejunum and ileum crypt depth and villus height without disrupting gut microbiota diversity in rats when administered at a dose of 0.9 mg/kg four days per week. Elsiglutide decreases diarrhea severity and incidence induced by the...
| Anwendung: | Peptide, GLP-2 derivative |
| MW: | 4318 D |
ab 62,00 €
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)
Artikelnummer: Cay41332-10
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a derivative of the endogenous incretin hormone glucagon-like peptide 1 (GLP-1, Cay-24460).Formal Name:...
| Schlagworte: | (S)-N1-((S)-6-amino-1-(((S)-3-hydroxy-1-(((3S,7S)-8-(((S)-3-hydroxy-1-(((2S,3R)-3-hydroxy-1-oxo-1-(((S)-1-oxo-3-phenylprop... |
| Anwendung: | GLP-1 derivative |
| MW: | 3692.1 D |
ab 171,00 €
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (trifluoroacetate salt)
Artikelnummer: Cay41337-1
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a peptide.Formal Name:...
| Schlagworte: | (S)-N1-((S)-6-amino-1-(((S)-3-hydroxy-1-(((3S,7S)-8-(((S)-3-hydroxy-1-(((2S,3R)-3-hydroxy-1-(((S)-1-(((2S,3R)-3-hydroxy-1-... |
| Anwendung: | Peptide, GLP-1 mimic |
| MW: | 3850.2 D |
ab 116,00 €
GCG Protein, Human, Recombinant (His)
Artikelnummer: TGM-TMPJ-00742-10ug
Description: Glucagon is a secreted protein and belongs to the glucagon family. Glucagon can be cleved into 8 chains, playing an important role in initiating and maintaining hyperglycemic conditions in diabetes. Glucagon can regulates blood glucose by decreasing glycolysis and increasing gluconeogenesis. In...
| Schlagworte: | OXY, Incretin Hormone, Oxyntomodulin, Glicentin-Related Polypeptide, Glucagon-Like Peptide 2, Glucagon, GCG, GLP-1, GLP-2,... |
| MW: | 19 kD |
ab 181,00 €