Zu "K05215" wurden 22 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-P2RX1
Artikelnummer: ATA-HPA057678.100
Polyclonal Antibody against Human P2RX1, Gene description: purinergic receptor P2X 1, Alternative Gene Names: P2X1, Validated applications: ICC, Uniprot ID: P51575, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Ligand-gated ion channel with relatively...
| Schlagworte: | Anti-P2X1, Anti-P2RX1, Anti-ATP receptor, Anti-P2X purinoceptor 1, Anti-Purinergic receptor |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
NF023 hexasodium
Artikelnummer: TGM-TP2272-10mg
Description: NF023 hexasodium is a selective and competitive P2X1 receptor antagonist with IC50 values of 0.21 µM, 28.9 µM, > 50 µM, and > 100 µM for human [P2X1], [P2X3], [P2X2], and [P2X4]-mediated responses, respectively. Target: P2X Receptor. Smiles:...
| Schlagworte: | NF 023 hexasodium, NF 023 |
| Anwendung: | P2X1 receptor antagonist, HCV NS3 helicase inhibitor |
| CAS | 104869-31-0 |
| MW: | 1168.92 D |
ab 447,00 €
alpha,beta-Methylene ATP trisodium
Artikelnummer: TGM-T13541-100mg
Description: alpha,beta-Methylene ATP trisodium, a phosphonate analog of ATP, is a selective P2X agonist that induces enhanced contraction of UBSM. alpha,beta-Methylene ATP trisodium inhibits P2X1 and P2X3, but is inactive against P2X2, 4 and 7. Target: P2X Receptor. Smiles:...
| Anwendung: | P2X1 / P2X3 agonist |
| CAS | 1343364-54-4 |
| MW: | 571.15 D |
ab 1.650,00 €
NF449 (sodium salt)
Artikelnummer: Cay13324-5
NF449 is an analog of suramin that selectively inhibits P2X1 purinergic receptors (pIC50 = 6.3) with a potency 19-fold greater than at P2X3, P2Y1, P2Y2, or P2Y11. Through selective inhibition of the P2X1 receptor, 10 mg/kg NF449 has been used to decrease intravascular platelet aggregation in a mouse model of...
| Schlagworte: | 4,4',4'',4'''-[carbonylbis[imino-5,1,3-benzenetriylbis(carbonylimino)]]tetrakis-1,3-benzenedisulfonic acid, octasodium salt |
| Anwendung: | Suramin analog, P2X1 inhibitor |
| CAS | 627034-85-9 |
| MW: | 1505.1 D |
ab 52,00 €
alpha,beta-Methyleneadenosine 5'-triphosphate (sodium salt)
Artikelnummer: Cay10008956-5
alpha,beta-Methyleneadenosine 5'-triphosphate (alphabeta-methylene ATP) is a phosphonic analog of ATP that is characterized by the replacement of the bridging oxygen atom between the alpha- and beta-phosphate groups with methylene. It is an agonist of P2X purinoceptors P2X1 and P2X3 (EC50 = ~1 µM) and is ~1,000-fold...
| Schlagworte: | alphabeta-methylene ATP, 5'-[hydrogen P-[[hydroxy(phosphonooxy)phosphinyl]methyl]phosphonate] adenosine, trisodium salt |
| Anwendung: | P2X1 / P2X3 agonist |
| CAS | 1343364-54-4 |
| MW: | 571.2 D |
ab 85,00 €
TNP-ATP (triethylammonium salt)
Artikelnummer: Cay20902-5
TNP-ATP is a derivative of ATP and an antagonist at the purinergic receptor subtypes P2X1, P2X3, and P2X2/3 (IC50s = 6, 0.9, and 7 nM, respectively). It is selective for those receptor subtypes over P2X2, P2X4, and P2X7 receptors (IC50s = 2,000, 15,200, and >30,000 nM, respectively). TNP-ATP inhibits calcium flux in...
| Schlagworte: | ((3a'R,4'R,6'R,6a'R)-4'-(6-amino-9H-purin-9-yl)-6'-(((((((hydroxyoxidophosphoryl)oxy)oxidophosphoryl)oxy)oxidophosphoryl)o... |
| Anwendung: | P2X receptor antagonist, nucleotide binding site probe |
| MW: | 1123 D |
613,00 €
NF 023
Artikelnummer: Cay17234-1
NF 023 is a purinergic P2X1 receptor antagonist (IC50 = 0.21 µM). It is selective for P2X1 over P2X2-4 receptors (IC50s = >50, 28.9 and >100 µM, respectively). It inhibits alpha,beta-methylene ATP-induced vasoconstriction in isolated rabbit saphenous arteries (pA2 = 5.69). NF 023 also inhibits hepatitis C virus...
| Schlagworte: | 8,8'-[carbonylbis(imino-3,1-phenylenecarbonylimino)]bis-1,3,5-naphthalenetrisulfonic acid, hexasodium salt |
| Anwendung: | P2X1 receptor antagonist, HCV NS3 helicase inhibitor |
| CAS | 104869-31-0 |
| MW: | 1162.9 D |
ab 53,00 €
Human P2RX1 full length protein-synthetic nanodisc
Artikelnummer: DIM-FLP100823.10
The protein encoded by this gene belongs to the P2X family of G-protein-coupled receptors. These proteins can form homo-and heterotimers and function as ATP-gated ion channels and mediate rapid and selective permeability to cations. This protein is primarily localized to smooth muscle where binds ATP and mediates...
| Schlagworte: | P2X1, P2RX1, ATP receptor, P2X purinoceptor 1, Purinergic receptor |
| Anwendung: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
| MW: | 45 kD |
ab 1.291,00 €
Human P2RX1-Strep full length protein-synthetic nanodisc
Artikelnummer: DIM-FLP120823.10
The protein encoded by this gene belongs to the P2X family of G-protein-coupled receptors. These proteins can form homo-and heterotimers and function as ATP-gated ion channels and mediate rapid and selective permeability to cations. This protein is primarily localized to smooth muscle where binds ATP and mediates...
| Schlagworte: | P2X1, P2RX1, ATP receptor, P2X purinoceptor 1, Purinergic receptor |
| Anwendung: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
| Exprimiert in: | Human cells |
| Ursprungsart: | human |
| MW: | 45 kD |
ab 1.162,00 €
P2RX1 (human), recombinant protein
Artikelnummer: ABS-PQ-298.20
| Schlagworte: | P2X purinoceptor 1, P2X1, ATP receptor, Purinergic receptor, Recombinant Human P2RX1 Protein |
| Exprimiert in: | human cells |
| Ursprungsart: | human |
| MW: | 51 kD |
ab 270,00 €
P2RX1 PrEST Antigen
Artikelnummer: ATA-APrEST95941.100
PrEST Antigen P2RX1, Gene description: purinergic receptor P2X 1, Alternative Gene Names: P2X1, Antigen sequence: LFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Ligand-gated ion channel with relatively...
| Schlagworte: | P2X1, P2RX1, ATP receptor, P2X purinoceptor 1, Purinergic receptor |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €
Anti-P2RX1, FITC conjugated
Artikelnummer: CSB-PA017319LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: P2RX1. Antigen Species: Human
| Schlagworte: | Anti-P2X1, Anti-P2RX1, Anti-ATP receptor, Anti-P2X purinoceptor 1, Anti-Purinergic receptor, ATP receptor antibody,... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €