Zu "K05215" wurden 22 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-P2RX1
Anti-P2RX1

Artikelnummer: ATA-HPA057678.100

Polyclonal Antibody against Human P2RX1, Gene description: purinergic receptor P2X 1, Alternative Gene Names: P2X1, Validated applications: ICC, Uniprot ID: P51575, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Ligand-gated ion channel with relatively...
Schlagworte: Anti-P2X1, Anti-P2RX1, Anti-ATP receptor, Anti-P2X purinoceptor 1, Anti-Purinergic receptor
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
477,00 €
Bewerten
NF023 hexasodium
NF023 hexasodium

Artikelnummer: TGM-TP2272-10mg

Description: NF023 hexasodium is a selective and competitive P2X1 receptor antagonist with IC50 values of 0.21 µM, 28.9 µM, > 50 µM, and > 100 µM for human [P2X1], [P2X3], [P2X2], and [P2X4]-mediated responses, respectively. Target: P2X Receptor. Smiles:...
Schlagworte: NF 023 hexasodium, NF 023
Anwendung: P2X1 receptor antagonist, HCV NS3 helicase inhibitor
CAS 104869-31-0
MW: 1168.92 D
ab 447,00 €
Bewerten
alpha,beta-Methylene ATP trisodium
alpha,beta-Methylene ATP trisodium

Artikelnummer: TGM-T13541-100mg

Description: alpha,beta-Methylene ATP trisodium, a phosphonate analog of ATP, is a selective P2X agonist that induces enhanced contraction of UBSM. alpha,beta-Methylene ATP trisodium inhibits P2X1 and P2X3, but is inactive against P2X2, 4 and 7. Target: P2X Receptor. Smiles:...
Anwendung: P2X1 / P2X3 agonist
CAS 1343364-54-4
MW: 571.15 D
ab 1.650,00 €
Bewerten
NF449 (sodium salt)
NF449 (sodium salt)

Artikelnummer: Cay13324-5

NF449 is an analog of suramin that selectively inhibits P2X1 purinergic receptors (pIC50 = 6.3) with a potency 19-fold greater than at P2X3, P2Y1, P2Y2, or P2Y11. Through selective inhibition of the P2X1 receptor, 10 mg/kg NF449 has been used to decrease intravascular platelet aggregation in a mouse model of...
Schlagworte: 4,4',4'',4'''-[carbonylbis[imino-5,1,3-benzenetriylbis(carbonylimino)]]tetrakis-1,3-benzenedisulfonic acid, octasodium salt
Anwendung: Suramin analog, P2X1 inhibitor
CAS 627034-85-9
MW: 1505.1 D
ab 52,00 €
Bewerten
alpha,beta-Methyleneadenosine 5'-triphosphate (sodium salt)
alpha,beta-Methyleneadenosine 5'-triphosphate (sodium salt)

Artikelnummer: Cay10008956-5

alpha,beta-Methyleneadenosine 5'-triphosphate (alphabeta-methylene ATP) is a phosphonic analog of ATP that is characterized by the replacement of the bridging oxygen atom between the alpha- and beta-phosphate groups with methylene. It is an agonist of P2X purinoceptors P2X1 and P2X3 (EC50 = ~1 µM) and is ~1,000-fold...
Schlagworte: alphabeta-methylene ATP, 5'-[hydrogen P-[[hydroxy(phosphonooxy)phosphinyl]methyl]phosphonate] adenosine, trisodium salt
Anwendung: P2X1 / P2X3 agonist
CAS 1343364-54-4
MW: 571.2 D
ab 85,00 €
Bewerten
TNP-ATP (triethylammonium salt)
TNP-ATP (triethylammonium salt)

Artikelnummer: Cay20902-5

TNP-ATP is a derivative of ATP and an antagonist at the purinergic receptor subtypes P2X1, P2X3, and P2X2/3 (IC50s = 6, 0.9, and 7 nM, respectively). It is selective for those receptor subtypes over P2X2, P2X4, and P2X7 receptors (IC50s = 2,000, 15,200, and >30,000 nM, respectively). TNP-ATP inhibits calcium flux in...
Schlagworte: ((3a'R,4'R,6'R,6a'R)-4'-(6-amino-9H-purin-9-yl)-6'-(((((((hydroxyoxidophosphoryl)oxy)oxidophosphoryl)oxy)oxidophosphoryl)o...
Anwendung: P2X receptor antagonist, nucleotide binding site probe
MW: 1123 D
613,00 €
Bewerten
NF 023
NF 023

Artikelnummer: Cay17234-1

NF 023 is a purinergic P2X1 receptor antagonist (IC50 = 0.21 µM). It is selective for P2X1 over P2X2-4 receptors (IC50s = >50, 28.9 and >100 µM, respectively). It inhibits alpha,beta-methylene ATP-induced vasoconstriction in isolated rabbit saphenous arteries (pA2 = 5.69). NF 023 also inhibits hepatitis C virus...
Schlagworte: 8,8'-[carbonylbis(imino-3,1-phenylenecarbonylimino)]bis-1,3,5-naphthalenetrisulfonic acid, hexasodium salt
Anwendung: P2X1 receptor antagonist, HCV NS3 helicase inhibitor
CAS 104869-31-0
MW: 1162.9 D
ab 53,00 €
Bewerten
Human P2RX1 full length protein-synthetic nanodisc
Human P2RX1 full length protein-synthetic nanodisc

Artikelnummer: DIM-FLP100823.10

The protein encoded by this gene belongs to the P2X family of G-protein-coupled receptors. These proteins can form homo-and heterotimers and function as ATP-gated ion channels and mediate rapid and selective permeability to cations. This protein is primarily localized to smooth muscle where binds ATP and mediates...
Schlagworte: P2X1, P2RX1, ATP receptor, P2X purinoceptor 1, Purinergic receptor
Anwendung: Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization
Exprimiert in: Human cells
Ursprungsart: human
MW: 45 kD
ab 1.291,00 €
Bewerten
Human P2RX1-Strep full length protein-synthetic nanodisc
Human P2RX1-Strep full length protein-synthetic nanodisc

Artikelnummer: DIM-FLP120823.10

The protein encoded by this gene belongs to the P2X family of G-protein-coupled receptors. These proteins can form homo-and heterotimers and function as ATP-gated ion channels and mediate rapid and selective permeability to cations. This protein is primarily localized to smooth muscle where binds ATP and mediates...
Schlagworte: P2X1, P2RX1, ATP receptor, P2X purinoceptor 1, Purinergic receptor
Anwendung: Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization
Exprimiert in: Human cells
Ursprungsart: human
MW: 45 kD
ab 1.162,00 €
Bewerten
P2RX1 (human), recombinant protein
P2RX1 (human), recombinant protein

Artikelnummer: ABS-PQ-298.20

Schlagworte: P2X purinoceptor 1, P2X1, ATP receptor, Purinergic receptor, Recombinant Human P2RX1 Protein
Exprimiert in: human cells
Ursprungsart: human
MW: 51 kD
ab 270,00 €
Bewerten
P2RX1 PrEST Antigen
P2RX1 PrEST Antigen

Artikelnummer: ATA-APrEST95941.100

PrEST Antigen P2RX1, Gene description: purinergic receptor P2X 1, Alternative Gene Names: P2X1, Antigen sequence: LFIKNSISFPRFKVNRRNLVEEVNAAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Ligand-gated ion channel with relatively...
Schlagworte: P2X1, P2RX1, ATP receptor, P2X purinoceptor 1, Purinergic receptor
Exprimiert in: E.coli
Ursprungsart: human
265,00 €
Bewerten
Anti-P2RX1, FITC conjugated
Anti-P2RX1, FITC conjugated

Artikelnummer: CSB-PA017319LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: P2RX1. Antigen Species: Human
Schlagworte: Anti-P2X1, Anti-P2RX1, Anti-ATP receptor, Anti-P2X purinoceptor 1, Anti-Purinergic receptor, ATP receptor antibody,...
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
1 von 2 Seiten