Zu "K04990" wurden 14 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-PKD2L1
Artikelnummer: ATA-HPA070002.100
Polyclonal Antibody against Human PKD2L1, Gene description: polycystin 2 like 1, transient receptor potential cation channel, Alternative Gene Names: PCL, PKD2L, PKDL, TRPP3, Validated applications: ICC, Uniprot ID: Q9P0L9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C....
| Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
Anti-PKD2L1
Artikelnummer: CSB-PA214505.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PKD2L1. Antigen Species: Human
| Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Anti-PKD2L1
Artikelnummer: CSB-PA960366.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: PKD2L1. Antigen Species: Human
| Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Phenamil (methanesulfonate)
Artikelnummer: Cay14308-5
Phenamil is an inhibitor of transient receptor potential polycystin-L (TRPP3, IC50 = 140 nM) and a derivative of amiloride (Cay-14409). It also inhibits the epithelial sodium channel (ENaC, IC50 = 400 nM). Phenamil decreases basal short-circuit currents in human and ovine bronchial epithelial cells with IC50 values...
| Schlagworte: | 3,5-diamino-6-chloro-N-[imino(phenylamino)methyl]-2-pyrazinecarboxamide, monomethanesulfonate |
| Anwendung: | TRPP3 inhibitor |
| CAS | 1161-94-0 |
| MW: | 401.8 D |
ab 86,00 €
PKD2L1 (human), recombinant protein
Artikelnummer: ABS-PP-5501.20
| Schlagworte: | Polycystin-2-like protein 1, Polycystin-2L1, Polycystic kidney disease 2-like 1 protein, Polycystin-2 homolog,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 29.5 kD |
ab 90,00 €
PKD2L1 PrEST Antigen
Artikelnummer: ATA-APrEST96085.100
PrEST Antigen PKD2L1, Gene description: polycystin 2 like 1, transient receptor potential cation channel, Alternative Gene Names: PCL, PKD2L, PKDL, TRPP3, Antigen sequence: YNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
| Schlagworte: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €
Anti-PKD2L1
Artikelnummer: CSB-PA018062GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PKD2L1. Antigen Species: Human
| Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
Anti-PKD2L1
Artikelnummer: CSB-PA865199DSR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: PKD2L1. Antigen Species: Human
| Schlagworte: | Anti-PKD2L1, Anti-Polycystin-L, Anti-Polycystin-L1, Anti-Polycystin-2L1, Anti-Polycystin-2 homolog, Anti-Polycystic kidney... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
PKD2L1 (Vector pUC, Accession No. BC025665)
Artikelnummer: CSB-CL865199HU.10
Length: 2418 Sequence: atgaatgctg tgggaagtcc tgaggggcag gagctgcaaa agctggggag tggagcctgg gacaaccccg cctacagtgg tcccccttcc ccacacggga cgctgagagt ctgcaccatc tccagcacgg ggcctctcca gccccaaccc aagaagcctg aagatgaacc ccaggagacg gcatacagga cccaggtgtc cagctgctgc ctccatatct gtcaaggcat cagaggactt tggggaacaa ccctgactga...
| Schlagworte: | PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
879,00 €
PKD2L1, Human polycystic kidney disease 2-like 1, Real...
Artikelnummer: VHPS-6930
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | PKD2L, PKD2L1, Polycystin-L, Polycystin-L1, Polycystin-2L1, Polycystin-2 homolog, Polycystic kidney disease 2-like 1 protein |
| Anwendung: | RNA quantification |
44,00 €
Pkd2L1, Mouse In multiple Geneids, Real Time PCR Primer Set
Artikelnummer: VMPS-4782
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | PKD2L1, Pkd2l1, Polycystic kidney disease 2-like 1 |
| Anwendung: | RNA quantification |
44,00 €
Pkd2L1, Rat polycystic kidney disease 2-like 1, Real Time...
Artikelnummer: VRPS-4547
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Pkd2l1, rCG_57418, Pkd2l1_predicted, Polycystic kidney disease 2-like 1 (Predicted) |
| Anwendung: | RNA quantification |
53,00 €