Zu "K00804" wurden 27 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-GGPS1
Artikelnummer: ATA-HPA050727.100
Polyclonal Antibody against Human GGPS1, Gene description: geranylgeranyl diphosphate synthase 1, Alternative Gene Names: GGPPS1, Validated applications: ICC, WB, Uniprot ID: O95749, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Catalyzes the...
| Schlagworte: | Anti-GGPS1, Anti-GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.29, EC=2.5.1.10, Anti-GGPP synthase,... |
| Anwendung: | ICC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
Geranyl pyrophosphate triammonium
Artikelnummer: TGM-T35589-1mg
Description: Geranyl pyrophosphate is an intermediate in the mevalonate pathway. It is formed from dimethylallyl pyrophosphate and isopentenyl pyrophosphate by geranyl pyrophosphate synthase. Geranyl pyrophosphate is used in the biosynthesis of farnesyl pyrophosphate , geranylgeranyl pyrophosphate , cholesterol,...
| Anwendung: | Geranyl pyrophosphate synthase metabolite |
| CAS | 116057-55-7 |
| MW: | 365.304 D |
ab 323,00 €
Geranylgeranyl pyrophosphate synthase (GGPS1), human,...
Artikelnummer: CSB-EP009393HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-300aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MEKTQETVQR ILLEPYKYLL QLPGKQVRTK LSQAFNHWLK VPEDKLQIII EVTEMLHNAS LLIDDIEDNS KLRRGFPVAH SIYGIPSVIN SANYVYFLGL EKVLTLDHPD AVKLFTRQLL ELHQGQGLDI...
| Schlagworte: | GGPS1, GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.10, EC=2.5.1.29, GGPP synthase, Geranyltranstransferase,... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 50.9 kD |
ab 219,00 €
Geranyl Pyrophosphate (triammonium salt)
Artikelnummer: Cay63320-1
Geranyl pyrophosphate is an intermediate in the mevalonate pathway. It is formed from dimethylallyl pyrophosphate (DMAPP, Cay-63180) and isopentenyl pyrophosphate by geranyl pyrophosphate synthase. Geranyl pyrophosphate is used in the biosynthesis of farnesyl pyrophosphate (Cay-63250), geranylgeranyl pyrophosphate...
| Schlagworte: | GDP, Geranyl Diphosphate, GPP, 3E,7-dimethyl-2,6-octadienyl-diphosphoric acid, triammonium salt |
| Anwendung: | Geranyl pyrophosphate synthase metabolite |
| CAS | 116057-55-7 |
| MW: | 365.3 D |
ab 178,00 €
Anti-GGPS1
Artikelnummer: ARG41221.100
Protein function: Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins. [The UniProt Consortium]
| Schlagworte: | Anti-GGPS1, Anti-GGPPSase, EC=2.5.1.-, EC=2.5.1.1, EC=2.5.1.29, EC=2.5.1.10, Anti-GGPP synthase,... |
| Anwendung: | IHC (paraffin), WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
616,00 €
Anti-GGPS1
Artikelnummer: ATA-HPA029472.100
Protein function: Catalyzes the trans-addition of the three molecules of IPP onto DMAPP to form geranylgeranyl pyrophosphate, an important precursor of carotenoids and geranylated proteins. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen...
| Schlagworte: | Anti-GGPS1, Anti-GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.10, EC=2.5.1.29, Anti-GGPP synthase,... |
| Anwendung: | IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
477,00 €
NEU
Anti-BTS1
Artikelnummer: CSB-PA604898XA01SVG.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-BTS1, Anti-YPL069C, Anti-GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.29, EC=2.5.1.10, Anti-GGPP synthase,... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
ab 1.529,00 €
NEU
Anti-BTS1
Artikelnummer: CSB-PA762225XA01DOT.200
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-BTS1, Anti-AEL238C, Anti-GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.10, EC=2.5.1.29, Anti-GGPP synthase,... |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii) |
1.529,00 €
GGPS1 (human), recombinant protein
Artikelnummer: ABS-PP-4342.20
| Schlagworte: | Geranylgeranyl pyrophosphate synthase, GGPP synthase, GGPPSase, (2E, 6E)-farnesyl diphosphate synthase,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 36 kD |
ab 90,00 €
GGPS1 PrEST Antigen
Artikelnummer: ATA-APrEST95575.100
PrEST Antigen GGPS1, Gene description: geranylgeranyl diphosphate synthase 1, Alternative Gene Names: GGPPS1, Antigen sequence: HPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPTEEEYKAMVLQKTGGLFGLAVGLMQLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Schlagworte: | GGPS1, GGPPSase, EC=2.5.1.-, EC=2.5.1.1, EC=2.5.1.29, EC=2.5.1.10, GGPP synthase, Geranyltranstransferase,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
265,00 €
Anti-GGPS1
Artikelnummer: CSB-PA009393GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: GGPS1. Antigen Species: Human
| Schlagworte: | Anti-GGPS1, Anti-GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.10, EC=2.5.1.29, Anti-GGPP synthase,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
552,00 €
Anti-GGPS1, HRP conjugated
Artikelnummer: CSB-PA009393HB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: GGPS1. Antigen Species: Human
| Schlagworte: | Anti-GGPS1, Anti-GGPPSase, EC=2.5.1.1, EC=2.5.1.-, EC=2.5.1.10, EC=2.5.1.29, Anti-GGPP synthase,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €