- Suchergebnis für GeneID 8876
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 8876" wurden 25 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA046103.100
Polyclonal Antibody against Human VNN1, Gene description: vanin 1, Alternative Gene Names: Tiff66, Validated applications: ICC, Uniprot ID: O95497, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Amidohydrolase that hydrolyzes specifically one of the...
Schlagworte: | Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory... |
Anwendung: | ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
477,00 €
Artikelnummer: TGM-TMPY-01403-50ug
Description: VNN1 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 53.7 kDa and the accession number is O95497.
Schlagworte: | vanin 1, Tiff66, HDLCQ8 |
MW: | 53.7 kD |
319,00 €
Artikelnummer: G-HUFI01321.96
Anwendung: | ELISA |
Spezies-Reaktivität: | human |
641,00 €
Artikelnummer: ARG59214.50
Protein function: Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. [The UniProt Consortium]
Schlagworte: | Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory... |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
551,00 €
Artikelnummer: E-AB-53205.120
This gene encodes a member of the vanin family of proteins, which share extensive sequence similarity with each other, and also with biotinidase. The family includes secreted and membrane-associated proteins, a few of which have been reported to participate in hematopoietic cell trafficking. No biotinidase activity...
Schlagworte: | Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory... |
Anwendung: | IF, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 89,00 €
Artikelnummer: G-HUES03490.96
ELISA Type: Sandwich. Sensitivity: 0.188ng/mL. Range: 0.313--20ng/mL. Protein function: Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. [The UniProt Consortium]
Schlagworte: | VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1 |
Anwendung: | Sandwich ELISA |
Spezies-Reaktivität: | human |
641,00 €
Artikelnummer: ELK-ELK3314.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human VNN1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human VNN1. Next,...
Schlagworte: | VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1 |
Anwendung: | ELISA |
Spezies-Reaktivität: | human |
ab 374,00 €
NEU

Artikelnummer: G-RPCB0228.96
Endotoxin Levels: < 0.1 EU/µg of the protein by LAL method. Protein function: Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine. [The UniProt Consortium]
Schlagworte: | VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1 |
Exprimiert in: | Human cells |
Ursprungsart: | human |
641,00 €

Artikelnummer: ATA-APrEST95589.100
PrEST Antigen VNN1, Gene description: vanin 1, Alternative Gene Names: Tiff66, Antigen sequence: VFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLYEKDWASNASSGLTAQARIIMLIVIAPIVCSLSW, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Amidohydrolase that hydrolyzes specifically one...
Schlagworte: | VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1 |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €

Artikelnummer: E-AB-40574.25
Vanin1 (VNN1) is a member of the biotinidase family and is expressed at the cell surface in epithelial cells . VNN1 is also known as vascular noninflammatory molecule 1. It does not possess biotinidase activity, but is a pantetheinase that catalyzes the hydrolysis of pantetheine to pantothenic acid (vitaminB5) and...
Schlagworte: | VNN1, Tiff66, Vanin-1, Pantetheinase, Pantetheine hydrolase, Vascular non-inflammatory molecule 1, Vanin1 Polyclonal Antibody |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
119,00 €

Artikelnummer: CSB-PA025883GA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.1% Sodium Azide, 50% Glycerol, pH 7.3. -20°C, Avoid freeze / thaw cycles. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: VNN1. Antigen Species: Human
Schlagworte: | Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory... |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
552,00 €

Artikelnummer: CSB-PA025883LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, pH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: VNN1. Antigen Species: Human
Schlagworte: | Anti-VNN1, Anti-Tiff66, Anti-Vanin-1, Anti-Pantetheinase, Anti-Pantetheine hydrolase, Anti-Vascular non-inflammatory... |
Anwendung: | ELISA, WB, IHC, IF |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €