Zu "GeneID 84449" wurden 16 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-ZNF333
Anti-ZNF333

Artikelnummer: ATA-HPA077662.100

Polyclonal Antibody against Human ZNF333, Gene description: zinc finger protein 333, Alternative Gene Names: KIAA1806, Validated applications: ICC, Uniprot ID: Q96JL9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May be involved in transcriptional...
Schlagworte: Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
477,00 €
Bewerten
Anti-ZNF333
Anti-ZNF333

Artikelnummer: ARG40063.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]
Schlagworte: Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
658,00 €
Bewerten
Anti-ZNF333
Anti-ZNF333

Artikelnummer: ATA-HPA043973.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 31% and to rat: 31%
Schlagworte: Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 358,00 €
Bewerten
Anti-ZNF333
Anti-ZNF333

Artikelnummer: ATA-HPA054680.100

Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 28% and to rat: 25%
Schlagworte: Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333
Anwendung: ICC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 239,00 €
Bewerten
ZNF333 (human), recombinant protein
ZNF333 (human), recombinant protein

Artikelnummer: ABS-PP-2631.100

Schlagworte: Zinc finger protein 333, Recombinant Human ZNF333 Protein
MW: 15.5 kD
ab 90,00 €
Bewerten
ZNF333 PrEST Antigen
ZNF333 PrEST Antigen

Artikelnummer: ATA-APrEST95831.100

PrEST Antigen ZNF333, Gene description: zinc finger protein 333, Alternative Gene Names: KIAA1806, Antigen sequence: QCQPQEAIPSQDTFTEILSIDVKGEQPQPGEKLYKYNELEKPFNSIEPLFQYQRIHAGEASCECQEIRNSFFQSAHLIVPEKIRSGDKSYACNKCE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be...
Schlagworte: ZNF333, KIAA1806, Zinc finger protein 333
Exprimiert in: E.coli
Ursprungsart: human
265,00 €
Bewerten
Anti-ZNF333, Biotin conjugated
Anti-ZNF333, Biotin conjugated

Artikelnummer: CSB-PA026681LD01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF333. Antigen Species: Human
Schlagworte: Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333, ZNF333 antibody, KIAA1806 antibody, Zinc finger protein 333...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-ZNF333
Anti-ZNF333

Artikelnummer: CSB-PA026681LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF333. Antigen Species: Human
Schlagworte: Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333, ZNF333 antibody, KIAA1806 antibody, Zinc finger protein 333...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-ZNF333, HRP conjugated
Anti-ZNF333, HRP conjugated

Artikelnummer: CSB-PA026681LB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF333. Antigen Species: Human
Schlagworte: Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333, ZNF333 antibody, KIAA1806 antibody, Zinc finger protein 333...
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
Anti-ZNF333, FITC conjugated
Anti-ZNF333, FITC conjugated

Artikelnummer: CSB-PA026681LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ZNF333. Antigen Species: Human
Schlagworte: Anti-ZNF333, Anti-KIAA1806, Anti-Zinc finger protein 333, ZNF333 antibody, KIAA1806 antibody, Zinc finger protein 333...
Wirt: Rabbit
Spezies-Reaktivität: human
ab 167,00 €
Bewerten
ZNF333 (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
ZNF333 (Vector Vector will be determined during the...

Artikelnummer: CSB-CL026681HU1.10

Length: 549 Sequence: atggaatccg tcacctttga ggatgtggcc gtggagttca tccaggagtg ggcattgctg gacagcgcac ggaggagcct gtgcaaatac aggatgcttg accagtgcag gaccctggcc tccaggggaa ctccaccatg caaacccagt tgtgtctccc agctggggca aagagcagag ccaaaggcaa cagaacgagg gattctccgt gccacaggtg ttgcctggga atctcaactt aaacccgaag agttgccttc...
Schlagworte: ZNF333, KIAA1806, Zinc finger protein 333
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
176,00 €
Bewerten
ZNF333 (Vector pUC, Accession No. BC048107)
ZNF333 (Vector pUC, Accession No. BC048107)

Artikelnummer: CSB-CL026681HU2.10

Length: 912 Sequence: atggaatccg tcacctttga ggatgtggcc gtggagttca tccaggagtg ggcattgctg gacagcgcac ggaggagcct gtgcaaatac aggatgcttg accagtgcag gaccctggcc tccaggggaa ctccaccatg caaacccagt tgtgtctccc agctggggca aagagcagag ccaaaggcaa cagaacgagg gattctccgt gccacaggtg ttgcctggga atctcaactt aaacccgaag agttgccttc...
Schlagworte: ZNF333, KIAA1806, Zinc finger protein 333
Anwendung: Molecular biology, clone
Spezies-Reaktivität: human
343,00 €
Bewerten
1 von 2 Seiten