- Suchergebnis für GeneID 8312
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 8312" wurden 20 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ABS-KC-1213.100
Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling (PubMed:12192039, PubMed:27098453). Controls dorsoventral patterning via two opposing effects, down-regulates CTNNB1 to inhibit the Wnt...
Schlagworte: | Anti-Axin-1, Anti-Axis inhibition protein 1, Anti-hAxin, AXIN1 Antibody |
Wirt: | Mouse |
Spezies-Reaktivität: | human |
ab 232,00 €
Artikelnummer: ATA-HPA073924.100
Polyclonal Antibody against Human AXIN1, Gene description: axin 1, Alternative Gene Names: PPP1R49, Validated applications: ICC, WB, Uniprot ID: O15169, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of the beta-catenin destruction complex...
Schlagworte: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1 |
Anwendung: | WB, ICC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
450,00 €
Artikelnummer: CSB-PA828936.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: AXIN1. Antigen Species: Human
Schlagworte: | Anti-AXIN, Anti-AXIN1, Anti-hAxin, Anti-Axin-1, Anti-Axis inhibition protein 1, axin 1, AXIN1 Antibody |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 167,00 €
Artikelnummer: CSB-PA914369.100
Host Species: Rabbit. Isotype: IgG. Buffer: -20°C, pH7.4 PBS, 0.05% NaN3, 40% Glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen affinity purification. Target Name: AXIN1. Antigen Species: Human
Schlagworte: | Anti-AXIN, Anti-AXIN1, Anti-hAxin, Anti-Axin-1, Anti-Axis inhibition protein 1, axin 1, AXIN1 Antibody |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 167,00 €
Artikelnummer: ARG63283.100
Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling. Controls dorsoventral patterning via two opposing effects, down-regulates CTNNB1 to inhibit the Wnt signaling pathway and ventralize...
Schlagworte: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1 |
Anwendung: | ELISA, IHC (paraffin) |
Wirt: | Goat |
Spezies-Reaktivität: | human |
822,00 €
Artikelnummer: G-HUFI02140.96
ELISA Type: Sandwich. Detection Range: 15.625-1000µg/mL. Sensitivity: 9.375µg/mL. Sample Types: Serum, Plasma. Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling (PubMed:12192039,...
Schlagworte: | AXIN, AXIN1, hAxin, Axin-1, Axis inhibition protein 1 |
Anwendung: | Sandwich ELISA |
Spezies-Reaktivität: | human |
641,00 €
Artikelnummer: NSJ-R34056-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Axis inhibition protein 1 Protein function: Component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating...
Schlagworte: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1, AXIN1 Antibody |
Anwendung: | IHC, ELISA (peptide) |
Wirt: | Goat |
Spezies-Reaktivität: | human |
790,00 €
Artikelnummer: NSJ-F45423-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. AXIN1 is a component of the beta-catenin destruction complex required for regulating CTNNB1 levels through phosphorylation and ubiquitination, and modulating Wnt-signaling. Controls dorsoventral patterning via two opposing effects, down-regulates CTNNB1 to inhibit the Wnt...
Schlagworte: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1, AXIN1 Antibody |
Anwendung: | WB, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 350,00 €
Artikelnummer: NSJ-F41872-0.08ML
In 1X PBS, pH 7.4, with 0.09% sodium azide. Axin-1 is a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2,...
Schlagworte: | Anti-AXIN, Anti-hAxin, Anti-AXIN1, Anti-Axin-1, Anti-Axis inhibition protein 1, Axin-1 Antibody |
Anwendung: | WB, IHC, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 350,00 €

Artikelnummer: ABS-PP-690.100
Schlagworte: | Axin-1, Axis inhibition protein 1, hAxin, Recombinant Human AXIN1 Protein |
MW: | 15.5 kD |
ab 90,00 €

Artikelnummer: ATA-APrEST95824.100
PrEST Antigen AXIN1, Gene description: axin 1, Alternative Gene Names: PPP1R49, Antigen sequence: AWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of the beta-catenin destruction...
Schlagworte: | AXIN, hAxin, AXIN1, Axin-1, Axis inhibition protein 1 |
Exprimiert in: | E.coli |
Ursprungsart: | human |
265,00 €

Artikelnummer: CSB-PA517675LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: AXIN1. Antigen Species: Human
Schlagworte: | Anti-AXIN, Anti-AXIN1, Anti-hAxin, Anti-Axin-1, Anti-Axis inhibition protein 1, AI316800 antibody, AXIN antibody, Axin 1... |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 167,00 €