Zu "GeneID 7862" wurden 9 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
BRPF1 (627-746), human recombinant protein, N-terminal His tag
BRPF1 (627-746), human recombinant protein, N-terminal...

Artikelnummer: BPS-31112

Human Bromodomain and PHD finger containing 1, or BRPF1, amino-acids 627 ? 746 (GenBank Accession No. NM_001003694) with N-terminal HIS-tag, MW = 15.1 kDa, expressed in an E. coli expression system.
Schlagworte: Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1,
Anwendung: BRD binding assays, inhibitor screening, selectivity profiling
Exprimiert in: E.coli
Ursprungsart: human
MW: 14.3 kD
461,00 €
Bewerten
Anti-BRPF1
Anti-BRPF1

Artikelnummer: ATA-HPA003359.100

Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Schlagworte: Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 239,00 €
Bewerten
BRPF1 (human), recombinant protein
BRPF1 (human), recombinant protein

Artikelnummer: ABS-PP-5851.100

Schlagworte: Peregrin, Bromodomain and PHD finger-containing protein 1, Protein Br140, Recombinant Human BRPF1 Protein
MW: 20.5 kD
ab 90,00 €
Bewerten
Anti-Bromodomain and PHD Finger Containing 1 (BRPF1, BR1
Anti-Bromodomain and PHD Finger Containing 1 (BRPF1, BR1

Artikelnummer: B2852-48.50

The protein encoded by this gene is expressed ubiquitously and at the highest level in testes and spermatogonia. The protein is localized within nuclei, and it is very similar in structure to two zinc finger proteins, AF10 and AF17. It is suggested that these proteins form a family of regulatory proteins. Two...
Schlagworte: Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1
Anwendung: ELISA, FC, IP, WB
Wirt: Mouse
Spezies-Reaktivität: human, mouse
543,00 €
Bewerten
BRPF1, Recombinant, Human, aa2054-2168, His-Tag (Bromodomain and PHD Finger Containing 1)
BRPF1, Recombinant, Human, aa2054-2168, His-Tag...

Artikelnummer: 298382.100

Source:, Recombinant protein corresponding to aa2054-2168 from human Bromodomain and PHD finger containing 1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.1kD, AA Sequence: MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPL, SEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDF,...
Schlagworte: Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1
MW: 15,1
937,00 €
Bewerten
BRPF1 PrEST Antigen
BRPF1 PrEST Antigen

Artikelnummer: ATA-APrEST84803.100

Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Schlagworte: Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
265,00 €
Bewerten
Anti-BRPF1
Anti-BRPF1

Artikelnummer: G-CAB17012.20

Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Schlagworte: Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1
Anwendung: WB, IF
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
149,00 €
Bewerten
Anti-BRPF1
Anti-BRPF1

Artikelnummer: ELK-ES18906.100

Protein function: Scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PubMed:16387653, PubMed:24065767, PubMed:27939640). Plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone...
Schlagworte: Anti-Peregrin, Anti-Protein Br140, Anti-Bromodomain and PHD finger-containing protein 1, BRPF1 rabbit pAb
Anwendung: WB
Wirt: Rabbit
Spezies-Reaktivität: human, rat, mouse,
ab 173,00 €
Bewerten
Anti-BRPF1
Anti-BRPF1

Artikelnummer: E-AB-91679.120

This gene encodes a bromodomain, PHD finger and chromo/Tudor-related Pro-Trp-Trp-Pro (PWWP) domain containing protein. The encoded protein is a component of the MOZ/MORF histone acetyltransferase complexes which function as a transcriptional regulators. This protein binds to the catalytic MYST domains of the MOZ and...
Schlagworte: Peregrin, Protein Br140, Bromodomain and PHD finger-containing protein 1, BRPF1 Polyclonal Antibody
Anwendung: WB, IF
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
ab 243,00 €
Bewerten